Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7200
Gene name Gene Name - the full gene name approved by the HGNC.	Thyrotropin releasing hormone
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TRH
Synonyms (NCBI Gene) Gene synonyms aliases	Pro-TRH, TRF
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-

Show/Hide all(45)

miRTarBase ID	miRNA	Experiments
MIRT1452491	hsa-miR-1343	CLIP-seq
MIRT1452492	hsa-miR-3151	CLIP-seq
MIRT1452493	hsa-miR-4257	CLIP-seq
MIRT1452494	hsa-miR-4447	CLIP-seq
MIRT1452495	hsa-miR-4472	CLIP-seq
MIRT1452496	hsa-miR-4476	CLIP-seq
MIRT1452497	hsa-miR-4533	CLIP-seq
MIRT1452498	hsa-miR-4650-5p	CLIP-seq
MIRT1452499	hsa-miR-4670-3p	CLIP-seq
MIRT1452500	hsa-miR-4690-5p	CLIP-seq
MIRT1452501	hsa-miR-4790-3p	CLIP-seq
MIRT1452502	hsa-miR-4797-5p	CLIP-seq
MIRT1452503	hsa-miR-486-3p	CLIP-seq
MIRT1452504	hsa-miR-541	CLIP-seq
MIRT1452505	hsa-miR-637	CLIP-seq
MIRT1452506	hsa-miR-654-5p	CLIP-seq
MIRT2135500	hsa-miR-2110	CLIP-seq
MIRT2135501	hsa-miR-3150a-3p	CLIP-seq
MIRT2135502	hsa-miR-3175	CLIP-seq
MIRT2135503	hsa-miR-939	CLIP-seq
MIRT2356657	hsa-miR-188-3p	CLIP-seq
MIRT2356658	hsa-miR-3591-3p	CLIP-seq
MIRT2356659	hsa-miR-4729	CLIP-seq
MIRT2356660	hsa-miR-4733-5p	CLIP-seq
MIRT2135500	hsa-miR-2110	CLIP-seq
MIRT2135501	hsa-miR-3150a-3p	CLIP-seq
MIRT2135502	hsa-miR-3175	CLIP-seq
MIRT2462305	hsa-miR-4728-5p	CLIP-seq
MIRT2462306	hsa-miR-4755-3p	CLIP-seq
MIRT2462307	hsa-miR-671-5p	CLIP-seq
MIRT2135503	hsa-miR-939	CLIP-seq
MIRT2135500	hsa-miR-2110	CLIP-seq
MIRT2135501	hsa-miR-3150a-3p	CLIP-seq
MIRT2135502	hsa-miR-3175	CLIP-seq
MIRT2462305	hsa-miR-4728-5p	CLIP-seq
MIRT2462306	hsa-miR-4755-3p	CLIP-seq
MIRT2462307	hsa-miR-671-5p	CLIP-seq
MIRT2135503	hsa-miR-939	CLIP-seq
MIRT2135500	hsa-miR-2110	CLIP-seq
MIRT2135501	hsa-miR-3150a-3p	CLIP-seq
MIRT2135502	hsa-miR-3175	CLIP-seq
MIRT2462305	hsa-miR-4728-5p	CLIP-seq
MIRT2462306	hsa-miR-4755-3p	CLIP-seq
MIRT2462307	hsa-miR-671-5p	CLIP-seq
MIRT2135503	hsa-miR-939	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
CREB1	Unknown	11134186;9827656
STAT3	Unknown	11134186

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001692	Process	Histamine metabolic process	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0007165	Process	Signal transduction	TAS	2126343
GO:0007267	Process	Cell-cell signaling	TAS	2126343
GO:0007628	Process	Adult walking behavior	IEA
GO:0008437	Function	Thyrotropin-releasing hormone activity	IBA
GO:0008437	Function	Thyrotropin-releasing hormone activity	IEA
GO:0008437	Function	Thyrotropin-releasing hormone activity	TAS	2126343
GO:0009755	Process	Hormone-mediated signaling pathway	IEA
GO:0014050	Process	Negative regulation of glutamate secretion	IBA
GO:0014054	Process	Positive regulation of gamma-aminobutyric acid secretion	IBA
GO:0030141	Component	Secretory granule	IBA
GO:0032024	Process	Positive regulation of insulin secretion	IBA
GO:0042755	Process	Eating behavior	IBA

MIM	HGNC	e!Ensembl
613879	12298	ENSG00000170893

Protein

UniProt ID

P20396

Protein name

Pro-thyrotropin-releasing hormone (Pro-TRH) (Prothyroliberin) [Cleaved into: Thyrotropin-releasing hormone (TRH) (Protirelin) (TSH-releasing factor) (Thyroliberin) (Thyrotropin-releasing factor) (TRF)]

Protein function

As a component of the hypothalamic-pituitary-thyroid axis, it controls the secretion of thyroid-stimulating hormone (TSH) and is involved in thyroid hormone synthesis regulation. It also operates as modulator of hair growth. It promotes hair-sha

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05438	TRH	6 → 206	Thyrotropin-releasing hormone (TRH)	Family

Tissue specificity

TISSUE SPECIFICITY: Hypothalamus. Expressed in the hair follicle epithelium (at protein level). {ECO:0000269|PubMed:19825978}.

Sequence

MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQ
RLQGDQGEHSASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRRE
DEASWSVDVTQHKRQHPGRRSPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDL
MPEKRQHPGKRALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL
EE

Sequence length

242

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling		Peptide ligand-binding receptors G alpha (q) signalling events

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hypothalamic hypothyroidism	hypothalamic hypothyroidism	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	22491060
Alopecia Areata	Associate	39205687
Anxiety Disorders	Stimulate	35964359
Breast Neoplasms	Associate	25362934
Carcinoma Renal Cell	Associate	22610075, 25332168
Carcinoma Squamous Cell	Associate	22491060
Combined Pituitary Hormone Deficiency	Associate	9745452
Down Syndrome	Associate	25362934
Endometrial Neoplasms	Associate	29693365
Hyperthyroidism	Associate	37876543
Hypothyroidism	Associate	26735259
Leukemia Myeloid Acute	Associate	36291567, 37027440, 37798266
Lung Neoplasms	Associate	20565977
Moyamoya Disease	Associate	38402855
Muscular Atrophy Spinal	Associate	26683872
Neoplasm Metastasis	Associate	22491060
Neoplasms	Associate	22491060, 30081853
Pigmentation Disorders	Associate	21956127
Squamous Cell Carcinoma of Head and Neck	Associate	30081853
Thyroid Hormone Resistance Syndrome	Associate	19299458, 7528740

TRH (thyrotropin releasing hormone)