Gene Gene information from NCBI Gene database.
Entrez ID 7188
Gene name TNF receptor associated factor 5
Gene symbol TRAF5
Synonyms (NCBI Gene)
MGC:39780RNF84
Chromosome 1
Chromosome location 1q32.3
Summary The scaffold protein encoded by this gene is a member of the tumor necrosis factor receptor-associated factor (TRAF) protein family and contains a meprin and TRAF homology (MATH) domain, a RING-type zinc finger, and two TRAF-type zinc fingers. TRAF protei
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs756183569 AGAG>- Likely-pathogenic Frameshift variant, coding sequence variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
380
miRTarBase ID miRNA Experiments Reference
MIRT553425 hsa-miR-8485 PAR-CLIP 21572407
MIRT553424 hsa-miR-329-3p PAR-CLIP 21572407
MIRT553423 hsa-miR-362-3p PAR-CLIP 21572407
MIRT553422 hsa-miR-603 PAR-CLIP 21572407
MIRT553421 hsa-miR-4789-3p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
41
GO ID Ontology Definition Evidence Reference
GO:0005164 Function Tumor necrosis factor receptor binding IEA
GO:0005515 Function Protein binding IPI 9153189, 9162022, 15121867, 21516116, 21822258, 22493164, 25241761, 25416956, 27107012, 28514442, 32296183, 32814053, 33961781
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 15121867
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602356 12035 ENSG00000082512
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00463
Protein name TNF receptor-associated factor 5 (RING finger protein 84)
Protein function Adapter protein and signal transducer that links members of the tumor necrosis factor receptor family to different signaling pathways by association with the receptor cytoplasmic domain and kinases. Mediates activation of NF-kappa-B and probably
PDB 7L3L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00097 zf-C3HC4 45 83 Zinc finger, C3HC4 type (RING finger) Domain
PF02176 zf-TRAF 128 183 TRAF-type zinc finger Family
PF02176 zf-TRAF 183 241 TRAF-type zinc finger Family
Tissue specificity TISSUE SPECIFICITY: Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon, and peripheral blood.
Sequence
MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGC
GHRFCQHCILSLRELNTVPICPV
DKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKV
ILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINL
QN
HEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQ
H
EHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFG
KNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLE
NNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA
VDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKD
DTLFLKVAVDLTDLEDL
Sequence length 557
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  NF-kappa B signaling pathway
Necroptosis
NOD-like receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Shigellosis
Human cytomegalovirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
 
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Multiple myeloma Likely pathogenic rs756183569 RCV000984094
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Chronic lymphocytic leukemia/small lymphocytic lymphoma Uncertain significance rs149548418 RCV005939283
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Inhibit 38088510
Arthritis Rheumatoid Associate 17277003
Atherosclerosis Associate 37330462
Autoimmune Diseases Associate 24020968, 24416204
Behcet Syndrome Associate 24416204
Carcinoma Hepatocellular Associate 30021196, 37366426
Carcinoma Ovarian Epithelial Associate 34983361
Colitis Stimulate 23329887
Colitis Ulcerative Associate 23329887
Colorectal Neoplasms Associate 29328486