TRAF3 (TNF receptor associated factor 3)

Gene

• Entrez ID: 7187
• Gene name: TNF receptor associated factor 3
• Gene symbol: TRAF3
• Synonyms (NCBI Gene): CAP-1, CAP1, CD40bp, CRAF1, IIAE5, IMD132A, IMD132B, LAP1, RNF118
• Chromosome: 14
• Chromosome location: 14q32.32
• Summary: The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs143813189	C>T	Risk-factor, likely-benign	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006827	hsa-miR-32-5p	Luciferase reporter assay	22709905
MIRT006827	hsa-miR-32-5p	Luciferase reporter assay	22709905
MIRT028936	hsa-miR-26b-5p	Microarray	19088304
MIRT568696	hsa-miR-662	HITS-CLIP	23824327
MIRT568695	hsa-miR-4286	HITS-CLIP	23824327
MIRT568693	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT568692	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT568691	hsa-miR-4455	HITS-CLIP	23824327
MIRT568690	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT568696	hsa-miR-662	PAR-CLIP	20371350
MIRT568695	hsa-miR-4286	PAR-CLIP	20371350
MIRT568694	hsa-miR-4694-5p	PAR-CLIP	20371350
MIRT568693	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT568692	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT568691	hsa-miR-4455	PAR-CLIP	20371350
MIRT568690	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT486131	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT486129	hsa-miR-4707-3p	PAR-CLIP	23592263
MIRT486128	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT486127	hsa-miR-8085	PAR-CLIP	23592263
MIRT486126	hsa-miR-3191-3p	PAR-CLIP	23592263
MIRT568695	hsa-miR-4286	HITS-CLIP	28735896
MIRT568695	hsa-miR-4286	HITS-CLIP	28735896
MIRT734857	hsa-miR-153-3p	RNA-seq	33491670
MIRT735174	hsa-miR-214-3p	Western blotting, qRT-PCR, ELISA	32670749
MIRT737231	hsa-miR-1307-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR, In situ hybridization	33061854
MIRT568696	hsa-miR-662	HITS-CLIP	23824327
MIRT568695	hsa-miR-4286	HITS-CLIP	23824327
MIRT568693	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT568692	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT568691	hsa-miR-4455	HITS-CLIP	23824327
MIRT568690	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT568696	hsa-miR-662	PAR-CLIP	20371350
MIRT568695	hsa-miR-4286	PAR-CLIP	20371350
MIRT568694	hsa-miR-4694-5p	PAR-CLIP	20371350
MIRT568693	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT568692	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT568691	hsa-miR-4455	PAR-CLIP	20371350
MIRT568690	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT486131	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT486129	hsa-miR-4707-3p	PAR-CLIP	23592263
MIRT486128	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT486127	hsa-miR-8085	PAR-CLIP	23592263
MIRT486126	hsa-miR-3191-3p	PAR-CLIP	23592263
MIRT756227	hsa-miR-95-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36727735
MIRT1450740	hsa-miR-1291	CLIP-seq
MIRT1450741	hsa-miR-1303	CLIP-seq
MIRT1450742	hsa-miR-146b-3p	CLIP-seq
MIRT1450743	hsa-miR-1915	CLIP-seq
MIRT1450744	hsa-miR-198	CLIP-seq
MIRT1450745	hsa-miR-3143	CLIP-seq
MIRT1450746	hsa-miR-3153	CLIP-seq
MIRT1450747	hsa-miR-329	CLIP-seq
MIRT1450748	hsa-miR-3613-3p	CLIP-seq
MIRT1450749	hsa-miR-362-3p	CLIP-seq
MIRT1450750	hsa-miR-3692	CLIP-seq
MIRT1450751	hsa-miR-3714	CLIP-seq
MIRT1450752	hsa-miR-3918	CLIP-seq
MIRT1450753	hsa-miR-3973	CLIP-seq
MIRT1450754	hsa-miR-4434	CLIP-seq
MIRT1450755	hsa-miR-4516	CLIP-seq
MIRT1450756	hsa-miR-4531	CLIP-seq
MIRT1450757	hsa-miR-4534	CLIP-seq
MIRT1450758	hsa-miR-4679	CLIP-seq
MIRT1450759	hsa-miR-4680-3p	CLIP-seq
MIRT1450760	hsa-miR-4685-5p	CLIP-seq
MIRT1450761	hsa-miR-4706	CLIP-seq
MIRT1450762	hsa-miR-4726-3p	CLIP-seq
MIRT1450763	hsa-miR-4728-3p	CLIP-seq
MIRT1450764	hsa-miR-4728-5p	CLIP-seq
MIRT1450765	hsa-miR-4749-5p	CLIP-seq
MIRT1450766	hsa-miR-4755-3p	CLIP-seq
MIRT1450767	hsa-miR-4768-3p	CLIP-seq
MIRT1450768	hsa-miR-4781-5p	CLIP-seq
MIRT1450769	hsa-miR-548a-5p	CLIP-seq
MIRT1450770	hsa-miR-548ab	CLIP-seq
MIRT1450771	hsa-miR-548ak	CLIP-seq
MIRT1450772	hsa-miR-548an	CLIP-seq
MIRT1450773	hsa-miR-548b-5p	CLIP-seq
MIRT1450774	hsa-miR-548c-5p	CLIP-seq
MIRT1450775	hsa-miR-548d-5p	CLIP-seq
MIRT1450776	hsa-miR-548h	CLIP-seq
MIRT1450777	hsa-miR-548i	CLIP-seq
MIRT1450778	hsa-miR-548j	CLIP-seq
MIRT1450779	hsa-miR-548w	CLIP-seq
MIRT1450780	hsa-miR-548y	CLIP-seq
MIRT1450781	hsa-miR-559	CLIP-seq
MIRT1450782	hsa-miR-607	CLIP-seq
MIRT1450783	hsa-miR-628-5p	CLIP-seq
MIRT1450784	hsa-miR-648	CLIP-seq
MIRT1450785	hsa-miR-665	CLIP-seq
MIRT1450786	hsa-miR-744	CLIP-seq
MIRT1450787	hsa-miR-933	CLIP-seq
MIRT1450788	hsa-miR-103a	CLIP-seq
MIRT1450789	hsa-miR-107	CLIP-seq
MIRT1450790	hsa-miR-1233	CLIP-seq
MIRT1450791	hsa-miR-1254	CLIP-seq
MIRT1450792	hsa-miR-1265	CLIP-seq
MIRT1450793	hsa-miR-128	CLIP-seq
MIRT1450794	hsa-miR-1285	CLIP-seq
MIRT1450795	hsa-miR-1290	CLIP-seq
MIRT1450740	hsa-miR-1291	CLIP-seq
MIRT1450796	hsa-miR-129-3p	CLIP-seq
MIRT1450797	hsa-miR-137	CLIP-seq
MIRT1450798	hsa-miR-139-5p	CLIP-seq
MIRT1450742	hsa-miR-146b-3p	CLIP-seq
MIRT1450799	hsa-miR-148a	CLIP-seq
MIRT1450800	hsa-miR-148b	CLIP-seq
MIRT1450801	hsa-miR-149	CLIP-seq
MIRT1450802	hsa-miR-152	CLIP-seq
MIRT1450803	hsa-miR-191	CLIP-seq
MIRT1450743	hsa-miR-1915	CLIP-seq
MIRT1450804	hsa-miR-1972	CLIP-seq
MIRT1450805	hsa-miR-214	CLIP-seq
MIRT1450806	hsa-miR-2355-3p	CLIP-seq
MIRT1450807	hsa-miR-2392	CLIP-seq
MIRT1450808	hsa-miR-27a	CLIP-seq
MIRT1450809	hsa-miR-27b	CLIP-seq
MIRT1450810	hsa-miR-299-3p	CLIP-seq
MIRT1450811	hsa-miR-3064-5p	CLIP-seq
MIRT1450812	hsa-miR-3116	CLIP-seq
MIRT1450813	hsa-miR-3120-3p	CLIP-seq
MIRT1450814	hsa-miR-3121-5p	CLIP-seq
MIRT1450815	hsa-miR-3127-3p	CLIP-seq
MIRT1450816	hsa-miR-3140-5p	CLIP-seq
MIRT1450817	hsa-miR-3145-5p	CLIP-seq
MIRT1450746	hsa-miR-3153	CLIP-seq
MIRT1450818	hsa-miR-3187-5p	CLIP-seq
MIRT1450819	hsa-miR-3194-3p	CLIP-seq
MIRT1450820	hsa-miR-3194-5p	CLIP-seq
MIRT1450821	hsa-miR-3607-3p	CLIP-seq
MIRT1450822	hsa-miR-3619-5p	CLIP-seq
MIRT1450823	hsa-miR-3667-3p	CLIP-seq
MIRT1450824	hsa-miR-3686	CLIP-seq
MIRT1450751	hsa-miR-3714	CLIP-seq
MIRT1450752	hsa-miR-3918	CLIP-seq
MIRT1450825	hsa-miR-3944-5p	CLIP-seq
MIRT1450826	hsa-miR-3960	CLIP-seq
MIRT1450753	hsa-miR-3973	CLIP-seq
MIRT1450827	hsa-miR-412	CLIP-seq
MIRT1450828	hsa-miR-4270	CLIP-seq
MIRT1450829	hsa-miR-4271	CLIP-seq
MIRT1450830	hsa-miR-4293	CLIP-seq
MIRT1450831	hsa-miR-4305	CLIP-seq
MIRT1450832	hsa-miR-4441	CLIP-seq
MIRT1450833	hsa-miR-4469	CLIP-seq
MIRT1450834	hsa-miR-4477b	CLIP-seq
MIRT1450835	hsa-miR-4479	CLIP-seq
MIRT1450836	hsa-miR-4511	CLIP-seq
MIRT1450837	hsa-miR-4646-3p	CLIP-seq
MIRT1450838	hsa-miR-4652-3p	CLIP-seq
MIRT1450758	hsa-miR-4679	CLIP-seq
MIRT1450760	hsa-miR-4685-5p	CLIP-seq
MIRT1450839	hsa-miR-4687-3p	CLIP-seq
MIRT1450840	hsa-miR-4696	CLIP-seq
MIRT1450761	hsa-miR-4706	CLIP-seq
MIRT1450841	hsa-miR-4711-3p	CLIP-seq
MIRT1450842	hsa-miR-4711-5p	CLIP-seq
MIRT1450843	hsa-miR-4722-5p	CLIP-seq
MIRT1450844	hsa-miR-4725-3p	CLIP-seq
MIRT1450762	hsa-miR-4726-3p	CLIP-seq
MIRT1450845	hsa-miR-4727-5p	CLIP-seq
MIRT1450846	hsa-miR-4731-5p	CLIP-seq
MIRT1450765	hsa-miR-4749-5p	CLIP-seq
MIRT1450766	hsa-miR-4755-3p	CLIP-seq
MIRT1450847	hsa-miR-4760-3p	CLIP-seq
MIRT1450848	hsa-miR-4763-5p	CLIP-seq
MIRT1450849	hsa-miR-4764-5p	CLIP-seq
MIRT1450767	hsa-miR-4768-3p	CLIP-seq
MIRT1450850	hsa-miR-4769-3p	CLIP-seq
MIRT1450768	hsa-miR-4781-5p	CLIP-seq
MIRT1450851	hsa-miR-4794	CLIP-seq
MIRT1450852	hsa-miR-4798-3p	CLIP-seq
MIRT1450853	hsa-miR-499-3p	CLIP-seq
MIRT1450854	hsa-miR-499a-3p	CLIP-seq
MIRT1450855	hsa-miR-513a-5p	CLIP-seq
MIRT1450856	hsa-miR-520d-5p	CLIP-seq
MIRT1450857	hsa-miR-524-5p	CLIP-seq
MIRT1450858	hsa-miR-539	CLIP-seq
MIRT1450769	hsa-miR-548a-5p	CLIP-seq
MIRT1450770	hsa-miR-548ab	CLIP-seq
MIRT1450771	hsa-miR-548ak	CLIP-seq
MIRT1450772	hsa-miR-548an	CLIP-seq
MIRT1450859	hsa-miR-548b-3p	CLIP-seq
MIRT1450773	hsa-miR-548b-5p	CLIP-seq
MIRT1450774	hsa-miR-548c-5p	CLIP-seq
MIRT1450775	hsa-miR-548d-5p	CLIP-seq
MIRT1450776	hsa-miR-548h	CLIP-seq
MIRT1450777	hsa-miR-548i	CLIP-seq
MIRT1450778	hsa-miR-548j	CLIP-seq
MIRT1450779	hsa-miR-548w	CLIP-seq
MIRT1450780	hsa-miR-548y	CLIP-seq
MIRT1450860	hsa-miR-550a	CLIP-seq
MIRT1450781	hsa-miR-559	CLIP-seq
MIRT1450861	hsa-miR-576-3p	CLIP-seq
MIRT1450862	hsa-miR-596	CLIP-seq
MIRT1450863	hsa-miR-600	CLIP-seq
MIRT1450864	hsa-miR-612	CLIP-seq
MIRT1450865	hsa-miR-615-3p	CLIP-seq
MIRT1450866	hsa-miR-661	CLIP-seq
MIRT1450785	hsa-miR-665	CLIP-seq
MIRT1450867	hsa-miR-711	CLIP-seq
MIRT1450868	hsa-miR-761	CLIP-seq
MIRT1450869	hsa-miR-802	CLIP-seq
MIRT1450870	hsa-miR-885-3p	CLIP-seq
MIRT1450871	hsa-miR-1202	CLIP-seq
MIRT1450872	hsa-miR-2467-5p	CLIP-seq
MIRT1450873	hsa-miR-3163	CLIP-seq
MIRT1450820	hsa-miR-3194-5p	CLIP-seq
MIRT1450874	hsa-miR-340	CLIP-seq
MIRT1450875	hsa-miR-3616-5p	CLIP-seq
MIRT1450876	hsa-miR-3647-5p	CLIP-seq
MIRT1450877	hsa-miR-3972	CLIP-seq
MIRT1450833	hsa-miR-4469	CLIP-seq
MIRT1450878	hsa-miR-4474-3p	CLIP-seq
MIRT1450879	hsa-miR-4722-3p	CLIP-seq
MIRT1450880	hsa-miR-4740-3p	CLIP-seq
MIRT1450881	hsa-miR-4795-5p	CLIP-seq
MIRT1450882	hsa-miR-503	CLIP-seq
MIRT1450855	hsa-miR-513a-5p	CLIP-seq
MIRT1450883	hsa-miR-548ad	CLIP-seq
MIRT1450884	hsa-miR-573	CLIP-seq
MIRT1450885	hsa-miR-595	CLIP-seq
MIRT1450886	hsa-miR-644	CLIP-seq
MIRT1450887	hsa-miR-658	CLIP-seq
MIRT1450788	hsa-miR-103a	CLIP-seq
MIRT1450789	hsa-miR-107	CLIP-seq
MIRT2134739	hsa-miR-1184	CLIP-seq
MIRT2134740	hsa-miR-1205	CLIP-seq
MIRT2134741	hsa-miR-1226	CLIP-seq
MIRT2134742	hsa-miR-1244	CLIP-seq
MIRT1450793	hsa-miR-128	CLIP-seq
MIRT1450794	hsa-miR-1285	CLIP-seq
MIRT2134743	hsa-miR-1286	CLIP-seq
MIRT2134744	hsa-miR-1322	CLIP-seq
MIRT1450797	hsa-miR-137	CLIP-seq
MIRT1450799	hsa-miR-148a	CLIP-seq
MIRT1450800	hsa-miR-148b	CLIP-seq
MIRT1450802	hsa-miR-152	CLIP-seq
MIRT2134745	hsa-miR-153	CLIP-seq
MIRT2134746	hsa-miR-15a	CLIP-seq
MIRT2134747	hsa-miR-15b	CLIP-seq
MIRT2134748	hsa-miR-16	CLIP-seq
MIRT2134749	hsa-miR-1825	CLIP-seq
MIRT1450803	hsa-miR-191	CLIP-seq
MIRT1450743	hsa-miR-1915	CLIP-seq
MIRT2134750	hsa-miR-195	CLIP-seq
MIRT2134751	hsa-miR-199a-3p	CLIP-seq
MIRT2134752	hsa-miR-199b-3p	CLIP-seq
MIRT1450805	hsa-miR-214	CLIP-seq
MIRT1450808	hsa-miR-27a	CLIP-seq
MIRT1450809	hsa-miR-27b	CLIP-seq
MIRT2134753	hsa-miR-3129-5p	CLIP-seq
MIRT2134754	hsa-miR-3158-5p	CLIP-seq
MIRT1450818	hsa-miR-3187-5p	CLIP-seq
MIRT2134755	hsa-miR-338-3p	CLIP-seq
MIRT1450874	hsa-miR-340	CLIP-seq
MIRT1450822	hsa-miR-3619-5p	CLIP-seq
MIRT2134756	hsa-miR-3646	CLIP-seq
MIRT2134757	hsa-miR-3647-3p	CLIP-seq
MIRT2134758	hsa-miR-3662	CLIP-seq
MIRT1450823	hsa-miR-3667-3p	CLIP-seq
MIRT1450751	hsa-miR-3714	CLIP-seq
MIRT1450825	hsa-miR-3944-5p	CLIP-seq
MIRT2134759	hsa-miR-424	CLIP-seq
MIRT2134760	hsa-miR-4267	CLIP-seq
MIRT1450831	hsa-miR-4305	CLIP-seq
MIRT1450754	hsa-miR-4434	CLIP-seq
MIRT2134761	hsa-miR-4436b-3p	CLIP-seq
MIRT2134762	hsa-miR-4443	CLIP-seq
MIRT2134763	hsa-miR-4457	CLIP-seq
MIRT2134764	hsa-miR-4468	CLIP-seq
MIRT1450833	hsa-miR-4469	CLIP-seq
MIRT2134765	hsa-miR-450b-5p	CLIP-seq
MIRT1450755	hsa-miR-4516	CLIP-seq
MIRT2134766	hsa-miR-4530	CLIP-seq
MIRT1450756	hsa-miR-4531	CLIP-seq
MIRT2134767	hsa-miR-4643	CLIP-seq
MIRT2134768	hsa-miR-4646-5p	CLIP-seq
MIRT2134769	hsa-miR-4676-5p	CLIP-seq
MIRT2134770	hsa-miR-4693-3p	CLIP-seq
MIRT2134771	hsa-miR-4700-3p	CLIP-seq
MIRT1450842	hsa-miR-4711-5p	CLIP-seq
MIRT2134772	hsa-miR-4715-3p	CLIP-seq
MIRT1450843	hsa-miR-4722-5p	CLIP-seq
MIRT1450762	hsa-miR-4726-3p	CLIP-seq
MIRT1450846	hsa-miR-4731-5p	CLIP-seq
MIRT2134773	hsa-miR-4733-3p	CLIP-seq
MIRT2134774	hsa-miR-4766-5p	CLIP-seq
MIRT1450767	hsa-miR-4768-3p	CLIP-seq
MIRT2134775	hsa-miR-486-3p	CLIP-seq
MIRT2134776	hsa-miR-497	CLIP-seq
MIRT2134777	hsa-miR-5095	CLIP-seq
MIRT2134778	hsa-miR-5096	CLIP-seq
MIRT1450855	hsa-miR-513a-5p	CLIP-seq
MIRT2134779	hsa-miR-513b	CLIP-seq
MIRT2134780	hsa-miR-521	CLIP-seq
MIRT1450858	hsa-miR-539	CLIP-seq
MIRT2134781	hsa-miR-542-3p	CLIP-seq
MIRT2134782	hsa-miR-544	CLIP-seq
MIRT2134783	hsa-miR-550b	CLIP-seq
MIRT2134784	hsa-miR-556-5p	CLIP-seq
MIRT2134785	hsa-miR-570	CLIP-seq
MIRT2134786	hsa-miR-575	CLIP-seq
MIRT1450863	hsa-miR-600	CLIP-seq
MIRT1450864	hsa-miR-612	CLIP-seq
MIRT2134787	hsa-miR-642b	CLIP-seq
MIRT2134788	hsa-miR-718	CLIP-seq
MIRT1450868	hsa-miR-761	CLIP-seq
MIRT1450869	hsa-miR-802	CLIP-seq
MIRT1450798	hsa-miR-139-5p	CLIP-seq
MIRT2356025	hsa-miR-147	CLIP-seq
MIRT2356026	hsa-miR-1911	CLIP-seq
MIRT2356027	hsa-miR-224	CLIP-seq
MIRT1450817	hsa-miR-3145-5p	CLIP-seq
MIRT2356028	hsa-miR-3185	CLIP-seq
MIRT2356029	hsa-miR-33a	CLIP-seq
MIRT2356030	hsa-miR-33b	CLIP-seq
MIRT2356031	hsa-miR-4738-3p	CLIP-seq
MIRT1450767	hsa-miR-4768-3p	CLIP-seq
MIRT2356032	hsa-miR-510	CLIP-seq
MIRT1450856	hsa-miR-520d-5p	CLIP-seq
MIRT2356033	hsa-miR-520g	CLIP-seq
MIRT2356034	hsa-miR-520h	CLIP-seq
MIRT1450857	hsa-miR-524-5p	CLIP-seq
MIRT2356035	hsa-miR-581	CLIP-seq
MIRT1450863	hsa-miR-600	CLIP-seq
MIRT2356036	hsa-miR-616	CLIP-seq
MIRT2356037	hsa-miR-892a	CLIP-seq
MIRT1450788	hsa-miR-103a	CLIP-seq
MIRT1450789	hsa-miR-107	CLIP-seq
MIRT1450798	hsa-miR-139-5p	CLIP-seq
MIRT2462272	hsa-miR-4304	CLIP-seq
MIRT2462273	hsa-miR-451b	CLIP-seq
MIRT1450856	hsa-miR-520d-5p	CLIP-seq
MIRT1450857	hsa-miR-524-5p	CLIP-seq
MIRT1450863	hsa-miR-600	CLIP-seq
MIRT2649500	hsa-miR-1207-3p	CLIP-seq
MIRT2649501	hsa-miR-1470	CLIP-seq
MIRT2649502	hsa-miR-4283	CLIP-seq
MIRT1450833	hsa-miR-4469	CLIP-seq
MIRT2649503	hsa-miR-4489	CLIP-seq
MIRT2649504	hsa-miR-4492	CLIP-seq
MIRT2649505	hsa-miR-4498	CLIP-seq
MIRT2649506	hsa-miR-4667-3p	CLIP-seq
MIRT2649507	hsa-miR-4690-3p	CLIP-seq
MIRT1450846	hsa-miR-4731-5p	CLIP-seq
MIRT2649508	hsa-miR-762	CLIP-seq
MIRT2649509	hsa-miR-766	CLIP-seq
MIRT2694024	hsa-miR-1182	CLIP-seq
MIRT2694025	hsa-miR-193a-5p	CLIP-seq
MIRT2694026	hsa-miR-2114	CLIP-seq
MIRT2694027	hsa-miR-3127-5p	CLIP-seq
MIRT2694028	hsa-miR-3182	CLIP-seq
MIRT2694029	hsa-miR-3660	CLIP-seq
MIRT2694030	hsa-miR-4256	CLIP-seq
MIRT2694031	hsa-miR-4526	CLIP-seq
MIRT1450766	hsa-miR-4755-3p	CLIP-seq
MIRT2694032	hsa-miR-554	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	NAS	21200404
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0001817	Process	Regulation of cytokine production	ISS
GO:0002224	Process	Toll-like receptor signaling pathway	IDA	18222170
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	ISS
GO:0002376	Process	Immune system process	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	19898473
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IPI	11728344
GO:0005515	Function	Protein binding	IPI	7527023, 10791955, 12005438, 12270937, 14743216, 15280356, 19419966, 19893624, 20080758, 20138174, 20174559, 20732415, 21903422, 23153539, 23333941, 23871208, 25241761, 27135603, 27387501, 27980081, 28514442, 30561431, 30833792, 31980649, 32296183, 32514408, 32707033, 33372174, 3396
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IC	16858409
GO:0005739	Component	Mitochondrion	IDA	19898473
GO:0005739	Component	Mitochondrion	IEA
GO:0005768	Component	Endosome	IDA	18222170
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	10799510
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	7530216
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0008063	Process	Toll signaling pathway	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009299	Process	MRNA transcription	IDA	9891032
GO:0009898	Component	Cytoplasmic side of plasma membrane	IBA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0010008	Component	Endosome membrane	IDA	18222170
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019903	Function	Protein phosphatase binding	IPI	23871208
GO:0030162	Process	Regulation of proteolysis	IEA
GO:0030162	Process	Regulation of proteolysis	IMP	20185819
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0031996	Function	Thioesterase binding	IEA
GO:0031996	Function	Thioesterase binding	IPI	11279055
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	20185819
GO:0032479	Process	Regulation of type I interferon production	IEA
GO:0032481	Process	Positive regulation of type I interferon production	IDA	14703513, 25636800, 29441066, 32130408
GO:0032481	Process	Positive regulation of type I interferon production	IDA	19898473
GO:0032648	Process	Regulation of interferon-beta production	IEA
GO:0032648	Process	Regulation of interferon-beta production	ISS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	20185819
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	25636800, 28747347
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	18222170
GO:0035591	Function	Signaling adaptor activity	IBA
GO:0035631	Component	CD40 receptor complex	IEA
GO:0035631	Component	CD40 receptor complex	ISS
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050688	Process	Regulation of defense response to virus	IEA
GO:0050688	Process	Regulation of defense response to virus	ISS
GO:0051607	Process	Defense response to virus	NAS	24622840, 25847972
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	25847972
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	19898473
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0140374	Process	Antiviral innate immune response	IDA	9891032, 14703513
GO:1902554	Component	Serine/threonine protein kinase complex	NAS	24622840

Other IDs

• MIM: 601896
• HGNC: 12033
• e!Ensembl: ENSG00000131323

Protein

• UniProt ID: Q13114
• Protein name: TNF receptor-associated factor 3 (EC 2.3.2.27) (CD40 receptor-associated factor 1) (CRAF1) (CD40-binding protein) (CD40BP) (LMP1-associated protein 1) (LAP1) (RING-type E3 ubiquitin transferase TRAF3)
• Protein function: Cytoplasmic E3 ubiquitin ligase that regulates various signaling pathways, such as the NF-kappa-B, mitogen-activated protein kinase (MAPK) and interferon regulatory factor (IRF) pathways, and thus controls a lot of biological processes in both i
• PDB: 1FLK, 1FLL, 1KZZ, 1L0A, 1RF3, 1ZMS, 2ECY, 2GKW, 8T5P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02176	zf-TRAF	136 → 192	TRAF-type zinc finger	Family
  PF02176	zf-TRAF	192 → 251	TRAF-type zinc finger	Family

• Sequence:

  MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVL
  CSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
  SRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHC
  KSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
  FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
  EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
  VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
  KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
  EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
  TVLENGTYIKDDTIFIKVIVDTSDLPDP

• Sequence length: 568

Pathways

KEGG:

NF-kappa B signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Alcoholic liver disease
Hepatitis C
Hepatitis B
Measles
Influenza A
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Coronavirus disease - COVID-19
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Lipid and atherosclerosis

Reactome:

TRAF3 deficiency - HSE
TNFR2 non-canonical NF-kB pathway
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
Ovarian tumor domain proteases
TICAM1-dependent activation of IRF3/IRF7
TRAF3-dependent IRF activation pathway
Negative regulators of DDX58/IFIH1 signaling
Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Herpes simplex encephalitis, susceptibility to, 3	Pathogenic	rs2542619877	RCV004566621	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TRAF3 haploinsufficiency	Pathogenic	rs2542634545	RCV003325323	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TRAF3-related disorder	Pathogenic	rs2542619877	RCV004759418	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANXIETY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ependymoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 132A	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunodeficiency 132b	Uncertain significance	ClinVar ClinVar, HPO ClinVar, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multisystem inflammatory syndrome in children	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIALOLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Associate	37798663	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Stimulate	20643858	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	36253437	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Associate	19825990	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	26981887, 32579175, 34745496	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Associate	28753533	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	28753533	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Associate	28753533	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	31539122	★☆☆☆☆ Found in Text Mining only
Cholecystitis	Associate	30692554	★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Associate	30692554	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Stimulate	23329887	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Stimulate	23329887	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	34257589	★☆☆☆☆ Found in Text Mining only
Communicable Diseases	Associate	37097293	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Associate	31539122	★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	27164085	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Stimulate	23329887	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	33901562	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	35142878	★☆☆☆☆ Found in Text Mining only
Encephalitis Herpes Simplex	Associate	20832341, 21722947, 22105173	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Associate	30692554	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Associate	28295216, 29921694	★☆☆☆☆ Found in Text Mining only
Hereditary leiomyomatosis and renal cell cancer	Associate	11023520, 22469134	★☆☆☆☆ Found in Text Mining only
Hip Injuries	Associate	21760914	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Associate	11023520, 22469134	★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	37005320	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Associate	11023520	★☆☆☆☆ Found in Text Mining only
Infections	Associate	20832341, 22792062	★☆☆☆☆ Found in Text Mining only
Infections	Inhibit	29813068	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	35481453, 37005320	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	23329887	★☆☆☆☆ Found in Text Mining only
Lead Poisoning Nervous System	Associate	38146363	★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	10595933, 26308964	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Associate	32132867	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	35472012	★☆☆☆☆ Found in Text Mining only
Leukemia Plasma Cell	Associate	35770320	★☆☆☆☆ Found in Text Mining only
Li Fraumeni Syndrome	Associate	7779715	★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Associate	12471121	★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell Marginal Zone	Associate	29765142	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Associate	14521460, 19656130	★☆☆☆☆ Found in Text Mining only
Microsatellite Instability	Associate	34257589	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	17692804, 17692805, 21228035, 24987674, 26036313, 28234347	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Inhibit	21228035	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	31039804, 34488019	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myasthenia Gravis	Associate	34279044	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	28098136	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	19825990, 2496060, 28981114, 29463311, 32132867, 3299054, 35634245, 37523561, 37798663	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	29921694, 34257589, 35770320	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Associate	8623922	★☆☆☆☆ Found in Text Mining only
Obesity	Associate	36253437	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	2496060, 30178836	★☆☆☆☆ Found in Text Mining only
Papillomavirus Infections	Associate	33164635	★☆☆☆☆ Found in Text Mining only
Paraproteinemias	Associate	36138464	★☆☆☆☆ Found in Text Mining only
Periodic fever familial autosomal dominant	Associate	31009059	★☆☆☆☆ Found in Text Mining only
Pulmonary Atelectasis	Associate	34089082	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Inhibit	29921694	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	35634245, 37523561, 9392004	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	35851310	★☆☆☆☆ Found in Text Mining only
Stroke	Associate	28753533	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Associate	12509453, 8751579	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	35631261, 37093683	★☆☆☆☆ Found in Text Mining only
Uniparental Disomy	Associate	19351844	★☆☆☆☆ Found in Text Mining only
Uniparental Disomy	Inhibit	22469134	★☆☆☆☆ Found in Text Mining only
Virus Diseases	Associate	19893624, 22792062	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Associate	19351844	★☆☆☆☆ Found in Text Mining only