Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7187
Gene name Gene Name - the full gene name approved by the HGNC.
TNF receptor associated factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRAF3
Synonyms (NCBI Gene) Gene synonyms aliases
CAP-1, CAP1, CD40bp, CRAF1, IIAE5, IMD132A, IMD132B, LAP1, RNF118
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q32.32
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs143813189 C>T Risk-factor, likely-benign Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006827 hsa-miR-32-5p Luciferase reporter assay 22709905
MIRT006827 hsa-miR-32-5p Luciferase reporter assay 22709905
MIRT028936 hsa-miR-26b-5p Microarray 19088304
MIRT568696 hsa-miR-662 HITS-CLIP 23824327
MIRT568695 hsa-miR-4286 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex NAS 21200404
GO:0001817 Process Regulation of cytokine production IEA
GO:0001817 Process Regulation of cytokine production ISS
GO:0002224 Process Toll-like receptor signaling pathway IDA 18222170
GO:0002224 Process Toll-like receptor signaling pathway IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601896 12033 ENSG00000131323
Protein
UniProt ID Q13114
Protein name TNF receptor-associated factor 3 (EC 2.3.2.27) (CD40 receptor-associated factor 1) (CRAF1) (CD40-binding protein) (CD40BP) (LMP1-associated protein 1) (LAP1) (RING-type E3 ubiquitin transferase TRAF3)
Protein function Cytoplasmic E3 ubiquitin ligase that regulates various signaling pathways, such as the NF-kappa-B, mitogen-activated protein kinase (MAPK) and interferon regulatory factor (IRF) pathways, and thus controls a lot of biological processes in both i
PDB 1FLK , 1FLL , 1KZZ , 1L0A , 1RF3 , 1ZMS , 2ECY , 2GKW , 8T5P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02176 zf-TRAF 136 192 TRAF-type zinc finger Family
PF02176 zf-TRAF 192 251 TRAF-type zinc finger Family
Sequence
MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVL
CSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
SRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMIALQK
HEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAH
EASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
Sequence length 568
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  NF-kappa B signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Alcoholic liver disease
Hepatitis C
Hepatitis B
Measles
Influenza A
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Coronavirus disease - COVID-19
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Lipid and atherosclerosis
  TRAF3 deficiency - HSE
TNFR2 non-canonical NF-kB pathway
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
Ovarian tumor domain proteases
TICAM1-dependent activation of IRF3/IRF7
TRAF3-dependent IRF activation pathway
Negative regulators of DDX58/IFIH1 signaling
Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma, Age of onset of childhood onset asthma, Asthma (childhood onset) N/A N/A GWAS
Breast Cancer Breast cancer N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37798663
Alzheimer Disease Stimulate 20643858
Asthma Associate 36253437
Breast Neoplasms Associate 19825990
Carcinoma Hepatocellular Associate 26981887, 32579175, 34745496
Cardiomegaly Associate 28753533
Cardiovascular Diseases Associate 28753533
Cerebral Infarction Associate 28753533
Cholangiocarcinoma Associate 31539122
Cholecystitis Associate 30692554