Gene Gene information from NCBI Gene database.
Entrez ID 7185
Gene name TNF receptor associated factor 1
Gene symbol TRAF1
Synonyms (NCBI Gene)
EBI6MGC:10353
Chromosome 9
Chromosome location 9q33.2
Summary The protein encoded by this gene is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form
miRNA miRNA information provided by mirtarbase database.
396
miRTarBase ID miRNA Experiments Reference
MIRT027456 hsa-miR-98-5p Microarray 19088304
MIRT028837 hsa-miR-26b-5p Microarray 19088304
MIRT043860 hsa-miR-378a-3p CLASH 23622248
MIRT709882 hsa-miR-361-3p HITS-CLIP 19536157
MIRT709881 hsa-miR-6778-3p HITS-CLIP 19536157
Transcription factors Transcription factors information provided by TRRUST V2 database.
5
Transcription factor Regulation Reference
NFKB1 Activation 11297551;17018379;19343319;9733827
NFKB1 Unknown 10823821;14991743;17673602
NFKBIA Repression 9733827
RELA Activation 11297551;17018379;19343319;9733827
RELA Unknown 10823821;14991743;17673602
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0005164 Function Tumor necrosis factor receptor binding IBA
GO:0005164 Function Tumor necrosis factor receptor binding IEA
GO:0005164 Function Tumor necrosis factor receptor binding IPI 11728344
GO:0005515 Function Protein binding IPI 8069916, 9208847, 11279055, 11907583, 14743216, 20447407, 21516116, 21911467, 21988832, 23088713, 23524849, 25241761, 25416956, 26871637, 27107012, 28514442, 29892012, 30561431, 31515488, 32296183, 33961781, 36217029
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601711 12031 ENSG00000056558
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13077
Protein name TNF receptor-associated factor 1 (Epstein-Barr virus-induced protein 6)
Protein function Adapter molecule that regulates the activation of NF-kappa-B and JNK. Plays a role in the regulation of cell survival and apoptosis. The heterotrimer formed by TRAF1 and TRAF2 is part of a E3 ubiquitin-protein ligase complex that promotes ubiqui
PDB 3M0D , 5E1T , 5H10
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16673 TRAF_BIRC3_bd 182 245 TNF receptor-associated factor BIRC3 binding domain Coiled-coil
Sequence
MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGE
DLQSISPGSRLRTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
GFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQH
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQ
QTLAQ
KDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK
YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST
Sequence length 416
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  NF-kappa B signaling pathway
Apoptosis
TNF signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Small cell lung cancer
  Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway