Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7185
Gene name Gene Name - the full gene name approved by the HGNC.
TNF receptor associated factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRAF1
Synonyms (NCBI Gene) Gene synonyms aliases
EBI6, MGC:10353
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q33.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027456 hsa-miR-98-5p Microarray 19088304
MIRT028837 hsa-miR-26b-5p Microarray 19088304
MIRT043860 hsa-miR-378a-3p CLASH 23622248
MIRT709882 hsa-miR-361-3p HITS-CLIP 19536157
MIRT709881 hsa-miR-6778-3p HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
NFKB1 Activation 11297551;17018379;19343319;9733827
NFKB1 Unknown 10823821;14991743;17673602
NFKBIA Repression 9733827
RELA Activation 11297551;17018379;19343319;9733827
RELA Unknown 10823821;14991743;17673602
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005164 Function Tumor necrosis factor receptor binding IBA 21873635
GO:0005164 Function Tumor necrosis factor receptor binding IPI 11728344
GO:0005515 Function Protein binding IPI 8069916, 9208847, 11279055, 11907583, 14743216, 20447407, 21516116, 21911467, 21988832, 23088713, 23524849, 25241761, 25416956, 26871637, 27107012, 28514442, 29892012, 30561431, 31515488, 32296183
GO:0005737 Component Cytoplasm TAS 8069916
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601711 12031 ENSG00000056558
Protein
UniProt ID Q13077
Protein name TNF receptor-associated factor 1 (Epstein-Barr virus-induced protein 6)
Protein function Adapter molecule that regulates the activation of NF-kappa-B and JNK. Plays a role in the regulation of cell survival and apoptosis. The heterotrimer formed by TRAF1 and TRAF2 is part of a E3 ubiquitin-protein ligase complex that promotes ubiqui
PDB 3M0D , 5E1T , 5H10
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16673 TRAF_BIRC3_bd 182 245 TNF receptor-associated factor BIRC3 binding domain Coiled-coil
Sequence
MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGE
DLQSISPGSRLRTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
GFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQH
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQ
QTLAQ
KDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK
YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST
Sequence length 416
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  NF-kappa B signaling pathway
Apoptosis
TNF signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Small cell lung cancer
  Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Autoimmune diseases Autoimmune Diseases rs869025224 21383967
Multiple sclerosis Multiple Sclerosis rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039
View all (4 more)
22190364
Patent ductus arteriosus Patent ductus arteriosus, Patent Ductus Arteriosus Familial rs80338911, rs879253870, rs879253871, rs879255278, rs879255279, rs879253872 19336370
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 17013881
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 26330267
Arthritis Associate 18593758, 20219786
Arthritis Juvenile Associate 18593758, 19674979, 19714643
Arthritis Rheumatoid Associate 17804836, 17880261, 18434327, 18593758, 18759306, 19116907, 19445664, 19503088, 19714643, 19741008, 20219786, 20353580, 21492465, 23125866, 23242182
View all (8 more)
Autoimmune Diseases Associate 21804190, 29339359, 32231389, 37108746
Breast Neoplasms Associate 24699530, 29339359
Burkitt Lymphoma Associate 9733827
Carcinogenesis Associate 35194031
Carcinoma Hepatocellular Associate 30021196
Carcinoma Squamous Cell Associate 22808251