CRISP2 (cysteine rich secretory protein 2)

Gene

• Entrez ID: 7180
• Gene name: Cysteine rich secretory protein 2
• Gene symbol: CRISP2
• Synonyms (NCBI Gene): CRISP-2, CT36, GAPDL5, TPX1, TSP1
• Chromosome: 6
• Chromosome location: 6p12.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437694	hsa-miR-27a-3p	Microarray, qRT-PCR	22815788
MIRT437703	hsa-miR-27b-3p	Microarray, qRT-PCR	22815788
MIRT437703	hsa-miR-27b-3p	qRT-PCR, Luciferase reporter assay, Western blot	25505194
MIRT909777	hsa-miR-501-3p	CLIP-seq
MIRT909778	hsa-miR-502-3p	CLIP-seq
MIRT909779	hsa-miR-640	CLIP-seq
MIRT909780	hsa-miR-767-5p	CLIP-seq
MIRT1920369	hsa-miR-128	CLIP-seq
MIRT1920370	hsa-miR-27a	CLIP-seq
MIRT1920371	hsa-miR-27b	CLIP-seq
MIRT1920372	hsa-miR-513a-5p	CLIP-seq
MIRT1920369	hsa-miR-128	CLIP-seq
MIRT1920370	hsa-miR-27a	CLIP-seq
MIRT1920371	hsa-miR-27b	CLIP-seq
MIRT1920372	hsa-miR-513a-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	TAS	8665901
GO:0019953	Process	Sexual reproduction	IBA

Other IDs

• MIM: 187430
• HGNC: 12024
• e!Ensembl: ENSG00000124490

Protein

• UniProt ID: P16562
• Protein name: Cysteine-rich secretory protein 2 (CRISP-2) (Cancer/testis antigen 36) (CT36) (Testis-specific protein TPX-1)
• Protein function: May regulate some ion channels' activity and thereby regulate calcium fluxes during sperm capacitation.
• PDB: 2CQ7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00188	CAP	41 → 169	Cysteine-rich secretory protein family	Domain
  PF08562	Crisp	189 → 243	Crisp	Domain

• Tissue specificity: TISSUE SPECIFICITY: Testis and epididymis.
• Sequence:

  MALLPVLFLVTVLLPSLPAEGKDPAFTALLTTQLQVQREIVNKHNELRKAVSPPASNMLK
  MEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSSAIQSWYDEILD
  FVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGNNMNRKN
  TPYQQGTPCAGCPDDCDKGLCTNSCQYQDLLSNCDSLKNTAGCEHELLKEKCKATCLCEN
  KIY

• Sequence length: 243

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CAROTID ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Arrest of spermatogenesis	Associate	16759931	★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Inhibit	27517483	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	28698603	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	33624385	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	28698603	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Associate	18687424	★☆☆☆☆ Found in Text Mining only
Infertility	Associate	27517483	★☆☆☆☆ Found in Text Mining only
Infertility Male	Inhibit	27517483	★☆☆☆☆ Found in Text Mining only
Infertility Male	Associate	34580317	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	36212177	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Associate	37705744	★☆☆☆☆ Found in Text Mining only
Squamous Intraepithelial Lesions	Associate	33624385	★☆☆☆☆ Found in Text Mining only
Syndrome	Associate	16759931	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	33624385	★☆☆☆☆ Found in Text Mining only
Varicocele	Associate	25890347	★☆☆☆☆ Found in Text Mining only