TPTE (transmembrane phosphatase with tensin homology)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7179
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane phosphatase with tensin homology
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TPTE
Synonyms (NCBI Gene) Gene synonyms aliases
CT44, PTEN2, TPTE1
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a PTEN-related tyrosine phosphatase which may play a role in the signal transduction pathways of the endocrine or spermatogenic function of the testis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Ma
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
miRTarBase ID miRNA Experiments Reference
MIRT1450475 hsa-miR-1207-5p CLIP-seq
MIRT1450476 hsa-miR-296-3p CLIP-seq
MIRT1450477 hsa-miR-3133 CLIP-seq
MIRT1450478 hsa-miR-3688-5p CLIP-seq
MIRT1450479 hsa-miR-3978 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(17)
GO ID Ontology Definition Evidence Reference
GO:0004725 Function Protein tyrosine phosphatase activity IBA 21873635
GO:0005634 Component Nucleus IBA 21873635
GO:0005829 Component Cytosol IBA 21873635
GO:0005886 Component Plasma membrane IBA 21873635
GO:0006470 Process Protein dephosphorylation IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604336 12023 ENSG00000274391
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P56180
Protein name Putative tyrosine-protein phosphatase TPTE (EC 3.1.3.48) (Cancer/testis antigen 44) (CT44) (Transmembrane phosphatase with tensin homology) (Tumor antigen BJ-HCC-5)
Protein function Could be involved in signal transduction.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00782 DSPc 265 → 385 Dual specificity phosphatase, catalytic domain Domain
PF10409 PTEN_C2 409 → 539 C2 domain of PTEN tumour-suppressor protein Domain
Tissue specificity TISSUE SPECIFICITY: Exclusively expressed in testis. {ECO:0000269|PubMed:10598804}.
Sequence 
MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESPHTSEFKGAARVSPISESVL
ARLSKFEVEDAENVASYDSKIKKIVHSIVSSFAFGLFGVFLVLLDVTLILADLIFTDSKL
YIPLEYRSISLAIALFFLMDVLLRVFVERRQQYFSDLFNILDTAIIVILLLVDVVYIFFD
IKLLRNIPRWTHLLRLLRLIILLRIFHLFHQKRQLEKLIRRRVSENKRRYTRDGFDLDLT
YVTERIIAMSFPSSGRQSFYRNPIKEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVV
RIMIDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHCKGGTDRTGTMVCAFLIASEICS
TAKESLYYFGERRTDKTHSEKFQGVKTPSQKRYVAYFAQVKHLYNWNLPPRRILFIKHFI
IYSIPRYVRDLKIQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQF
FYSNLPTYYDNCSFYFWLHTSFIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEK
MTSSDVVAGSD
Sequence length 551
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Synthesis of PIPs at the Golgi membrane
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Celiac disease Celiac disease GWAS
Show/Hide Text Mining Associations (8)
Associations from Text Mining
Disease Name Relationship Type References
Autistic Disorder Associate 26076356
Carcinoma Hepatocellular Associate 12865919
Carcinoma Non Small Cell Lung Associate 12865919
Colorectal Neoplasms Associate 34573430
Megalencephaly Associate 26076356
Neoplasms Associate 12865919, 34573430
Prostatic Neoplasms Associate 17977648
Testicular Neoplasms Associate 12865919