TPSAB1 (tryptase alpha/beta 1)

Gene

• Entrez ID: 7177
• Gene name: Tryptase alpha/beta 1
• Gene symbol: TPSAB1
• Synonyms (NCBI Gene): TPS1, TPS2, TPSB1, TPSB2, Tryptase-2
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes ar

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1450386	hsa-miR-1207-5p	CLIP-seq
MIRT1450387	hsa-miR-1538	CLIP-seq
MIRT1450388	hsa-miR-3135b	CLIP-seq
MIRT1450389	hsa-miR-3179	CLIP-seq
MIRT1450390	hsa-miR-3202	CLIP-seq
MIRT1450391	hsa-miR-3652	CLIP-seq
MIRT1450392	hsa-miR-3664-3p	CLIP-seq
MIRT1450393	hsa-miR-4430	CLIP-seq
MIRT1450394	hsa-miR-4436a	CLIP-seq
MIRT1450395	hsa-miR-4446-3p	CLIP-seq
MIRT1450396	hsa-miR-4492	CLIP-seq
MIRT1450397	hsa-miR-4498	CLIP-seq
MIRT1450398	hsa-miR-4688	CLIP-seq
MIRT1450399	hsa-miR-4721	CLIP-seq
MIRT1450400	hsa-miR-4728-5p	CLIP-seq
MIRT1450401	hsa-miR-4745-3p	CLIP-seq
MIRT1450402	hsa-miR-4763-3p	CLIP-seq
MIRT1450403	hsa-miR-4783-3p	CLIP-seq
MIRT1450404	hsa-miR-486-3p	CLIP-seq
MIRT1450405	hsa-miR-510	CLIP-seq
MIRT1450406	hsa-miR-762	CLIP-seq
MIRT2134637	hsa-miR-1909	CLIP-seq
MIRT2134638	hsa-miR-2278	CLIP-seq
MIRT2134639	hsa-miR-24	CLIP-seq
MIRT2134640	hsa-miR-4283	CLIP-seq
MIRT2134641	hsa-miR-4437	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	NAS	2187193
GO:0005515	Function	Protein binding	IPI	17474147
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006952	Process	Defense response	TAS	2677049
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	2677049
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	IDA	27068509
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0042802	Function	Identical protein binding	IPI	29661938

Other IDs

• MIM: 191080
• HGNC: 12019
• e!Ensembl: ENSG00000172236

Protein

• UniProt ID: Q15661
• Protein name: Tryptase alpha/beta-1 (Tryptase-1) (EC 3.4.21.59) (Tryptase I) (Tryptase alpha-1)
• Protein function: Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity. Isoform 2 cleaves large substrates, such as fibronectin, more
• PDB: 1LTO, 2F9N, 2F9O, 2F9P, 2ZEB, 2ZEC, 4A6L, 4MPU, 4MPV, 4MPW, 4MPX, 4MQA, 5F03, 5WI6, 6O1F, 6P0P, 6VVU, 8VGH, 8VGI, 8VGJ, 8VGK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	31 → 267	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed in lung, stomach, spleen, heart and skin; in these tissues, isoform 1 is predominant. Isoform 2 is expressed in aorta, spleen, and breast tumor, with highest levels in the endothelial cells of some
• Sequence:

  MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
  GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
  DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
  PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
  VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

• Sequence length: 275

Pathways

KEGG:

Influenza A

Reactome:

Activation of Matrix Metalloproteinases

<