Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7177
Gene name	Tryptase alpha/beta 1
Gene symbol	TPSAB1
Synonyms (NCBI Gene)	TPS1TPS2TPSB1TPSB2Tryptase-2
Chromosome	16
Chromosome location	16p13.3
Summary	Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes ar

Show/Hide all (26)

miRTarBase ID	miRNA	Experiments
MIRT1450386	hsa-miR-1207-5p	CLIP-seq
MIRT1450387	hsa-miR-1538	CLIP-seq
MIRT1450388	hsa-miR-3135b	CLIP-seq
MIRT1450389	hsa-miR-3179	CLIP-seq
MIRT1450390	hsa-miR-3202	CLIP-seq
MIRT1450391	hsa-miR-3652	CLIP-seq
MIRT1450392	hsa-miR-3664-3p	CLIP-seq
MIRT1450393	hsa-miR-4430	CLIP-seq
MIRT1450394	hsa-miR-4436a	CLIP-seq
MIRT1450395	hsa-miR-4446-3p	CLIP-seq
MIRT1450396	hsa-miR-4492	CLIP-seq
MIRT1450397	hsa-miR-4498	CLIP-seq
MIRT1450398	hsa-miR-4688	CLIP-seq
MIRT1450399	hsa-miR-4721	CLIP-seq
MIRT1450400	hsa-miR-4728-5p	CLIP-seq
MIRT1450401	hsa-miR-4745-3p	CLIP-seq
MIRT1450402	hsa-miR-4763-3p	CLIP-seq
MIRT1450403	hsa-miR-4783-3p	CLIP-seq
MIRT1450404	hsa-miR-486-3p	CLIP-seq
MIRT1450405	hsa-miR-510	CLIP-seq
MIRT1450406	hsa-miR-762	CLIP-seq
MIRT2134637	hsa-miR-1909	CLIP-seq
MIRT2134638	hsa-miR-2278	CLIP-seq
MIRT2134639	hsa-miR-24	CLIP-seq
MIRT2134640	hsa-miR-4283	CLIP-seq
MIRT2134641	hsa-miR-4437	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	NAS	2187193
GO:0005515	Function	Protein binding	IPI	17474147
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006952	Process	Defense response	TAS	2677049
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	2677049
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	IDA	27068509
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0042802	Function	Identical protein binding	IPI	29661938

MIM	HGNC	e!Ensembl
191080	12019	ENSG00000172236

Q15661

Protein name

Tryptase alpha/beta-1 (Tryptase-1) (EC 3.4.21.59) (Tryptase I) (Tryptase alpha-1)

Protein function

Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity. Isoform 2 cleaves large substrates, such as fibronectin, more

PDB

1LTO , 2F9N , 2F9O , 2F9P , 2ZEB , 2ZEC , 4A6L , 4MPU , 4MPV , 4MPW , 4MPX , 4MQA , 5F03 , 5WI6 , 6O1F , 6P0P , 6VVU , 8VGH , 8VGI , 8VGJ , 8VGK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00089	Trypsin	31 → 267	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed in lung, stomach, spleen, heart and skin; in these tissues, isoform 1 is predominant. Isoform 2 is expressed in aorta, spleen, and breast tumor, with highest levels in the endothelial cells of some

Sequence

MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

Sequence length

275

Interactions

View interactions

	KEGG		Reactome
	Influenza A		Activation of Matrix Metalloproteinases

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Benign	rs146223687	RCV005918140
Colon adenocarcinoma	Benign	rs146223687	RCV005918137
Colorectal cancer	Benign	rs146223687	RCV005918141
Familial cancer of breast	Benign	rs146223687, rs2234661	RCV005918136 RCV005920267
Gastric cancer	Benign	rs146223687	RCV005918143
Hepatocellular carcinoma	Benign	rs146223687	RCV005918138
Malignant tumor of esophagus	Benign	rs146223687	RCV005918139
Sarcoma	Benign	rs146223687	RCV005918142
Thymoma	Benign	rs146223687	RCV005918144
Uterine corpus endometrial carcinoma	Benign	rs146223687	RCV005918145

Show/Hide Text Mining Associations (21)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Anaphylaxis	Associate	37558059
Asthma	Associate	28933920, 37241840
Blood Coagulation Disorders	Associate	40629026
Bradycardia	Associate	34004232
Connective Tissue Diseases	Associate	27749843
Hepatitis E	Associate	34145303
Hereditary alpha tryptasemia syndrome	Associate	28933792, 32777817, 33481382, 33865872, 40649802
Hereditary alpha tryptasemia syndrome	Stimulate	36170795, 38287122
Immunologic Deficiency Syndromes	Associate	19748655
Inflammation	Associate	34637606
Irritable Bowel Syndrome	Associate	27749843
Leukemia Mast Cell	Associate	34925389
Mast Cell Activation Disorders	Associate	35008966
Mastocytosis	Associate	32777817
Mastocytosis Systemic	Associate	37558059
Optic Nerve Diseases	Associate	40160813
Primary Dysautonomias	Associate	27749843
Pulmonary Disease Chronic Obstructive	Associate	22871757, 34321876
Rhinitis Allergic	Associate	34637606
Sick Sinus Syndrome	Associate	34004232
Vasculitis Leukocytoclastic Cutaneous	Associate	27749843

TPSAB1 (tryptase alpha/beta 1)