Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7130
Gene name Gene Name - the full gene name approved by the HGNC.	TNF alpha induced protein 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TNFAIP6
Synonyms (NCBI Gene) Gene synonyms aliases	TSG-6, TSG6
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and c

Show/Hide all(44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT573255	hsa-miR-2052	PAR-CLIP	20371350
MIRT573256	hsa-miR-19a-5p	PAR-CLIP	20371350
MIRT573254	hsa-miR-19b-1-5p	PAR-CLIP	20371350
MIRT573253	hsa-miR-19b-2-5p	PAR-CLIP	20371350
MIRT573255	hsa-miR-2052	PAR-CLIP	20371350
MIRT573256	hsa-miR-19a-5p	PAR-CLIP	20371350
MIRT573254	hsa-miR-19b-1-5p	PAR-CLIP	20371350
MIRT573253	hsa-miR-19b-2-5p	PAR-CLIP	20371350
MIRT2647470	hsa-miR-137	CLIP-seq
MIRT2647471	hsa-miR-23a	CLIP-seq
MIRT2647472	hsa-miR-23b	CLIP-seq
MIRT2647473	hsa-miR-23c	CLIP-seq
MIRT2647474	hsa-miR-3160-5p	CLIP-seq
MIRT2647475	hsa-miR-337-3p	CLIP-seq
MIRT2647476	hsa-miR-3647-3p	CLIP-seq
MIRT2647477	hsa-miR-3685	CLIP-seq
MIRT2647478	hsa-miR-384	CLIP-seq
MIRT2647479	hsa-miR-3924	CLIP-seq
MIRT2647480	hsa-miR-4446-5p	CLIP-seq
MIRT2647481	hsa-miR-4517	CLIP-seq
MIRT2647482	hsa-miR-4654	CLIP-seq
MIRT2647483	hsa-miR-4712-3p	CLIP-seq
MIRT2647484	hsa-miR-4755-5p	CLIP-seq
MIRT2647485	hsa-miR-4769-5p	CLIP-seq
MIRT2647486	hsa-miR-561	CLIP-seq
MIRT2647487	hsa-miR-579	CLIP-seq
MIRT2647470	hsa-miR-137	CLIP-seq
MIRT2647471	hsa-miR-23a	CLIP-seq
MIRT2647472	hsa-miR-23b	CLIP-seq
MIRT2647473	hsa-miR-23c	CLIP-seq
MIRT2647474	hsa-miR-3160-5p	CLIP-seq
MIRT2647475	hsa-miR-337-3p	CLIP-seq
MIRT2647476	hsa-miR-3647-3p	CLIP-seq
MIRT2647477	hsa-miR-3685	CLIP-seq
MIRT2647478	hsa-miR-384	CLIP-seq
MIRT2647479	hsa-miR-3924	CLIP-seq
MIRT2647480	hsa-miR-4446-5p	CLIP-seq
MIRT2647481	hsa-miR-4517	CLIP-seq
MIRT2647482	hsa-miR-4654	CLIP-seq
MIRT2647483	hsa-miR-4712-3p	CLIP-seq
MIRT2647484	hsa-miR-4755-5p	CLIP-seq
MIRT2647485	hsa-miR-4769-5p	CLIP-seq
MIRT2647486	hsa-miR-561	CLIP-seq
MIRT2647487	hsa-miR-579	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
CEBPB	Activation	7876106
CEBPB	Unknown	7935377
CEBPD	Activation	23028973

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001550	Process	Ovarian cumulus expansion	IEA
GO:0001550	Process	Ovarian cumulus expansion	ISS
GO:0001968	Function	Fibronectin binding	IDA	18042364
GO:0005509	Function	Calcium ion binding	IDA	26468290
GO:0005515	Function	Protein binding	IPI	16771708, 18042364, 18586671, 22267482, 24501198, 26468290, 27044744
GO:0005540	Function	Hyaluronic acid binding	IDA	26468290, 26823460
GO:0005540	Function	Hyaluronic acid binding	IEA
GO:0005540	Function	Hyaluronic acid binding	TAS	1730767
GO:0005576	Component	Extracellular region	IDA	1730767
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006954	Process	Inflammatory response	TAS	1730767
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	TAS	1730767
GO:0007267	Process	Cell-cell signaling	TAS	1730767
GO:0016787	Function	Hydrolase activity	IEA
GO:0030212	Process	Hyaluronan metabolic process	IDA	20463016, 26468290
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IDA	16771708
GO:0045668	Process	Negative regulation of osteoblast differentiation	IDA	16771708, 18586671
GO:0045671	Process	Negative regulation of osteoclast differentiation	IDA	18586671
GO:0046872	Function	Metal ion binding	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IBA
GO:0050728	Process	Negative regulation of inflammatory response	IDA	21569482
GO:0090024	Process	Negative regulation of neutrophil chemotaxis	IDA	24501198
GO:0106435	Function	Carboxylesterase activity	IDA	16873769, 20463016
GO:1903911	Process	Positive regulation of receptor clustering	IDA	26823460
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:1905590	Process	Fibronectin fibril organization	IDA	18042364

MIM	HGNC	e!Ensembl
600410	11898	ENSG00000123610

Protein

UniProt ID

P98066

Protein name

Tumor necrosis factor-inducible gene 6 protein (EC 3.1.1.-) (Hyaluronate-binding protein) (TNF-stimulated gene 6 protein) (TSG-6) (Tumor necrosis factor alpha-induced protein 6) (TNF alpha-induced protein 6)

Protein function

Major regulator of extracellular matrix organization during tissue remodeling (PubMed:15917224, PubMed:18042364, PubMed:26823460). Catalyzes the transfer of a heavy chain (HC) from inter-alpha-inhibitor (I-alpha-I) complex to hyaluronan. Cleaves

PDB

1O7B , 1O7C , 2N40 , 2PF5 , 2WNO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00193	Xlink	36 → 128	Extracellular link domain	Domain
PF00431	CUB	135 → 244	CUB domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in airway epithelium and submucosal gland (at protein level). Colocalizes with bikunin at the ciliary border. Present in bronchoalveolar lavage fluid (at protein level) (PubMed:16873769). Expressed in mesenchymal stem cells (

Sequence

MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEF
EGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRS
ERWDAYCYNPHAKECGGVFTDPKQIFKSPGFPNEYEDNQICYWHIRLKYGQRIHLSFLDF
DLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGF
QIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL

Sequence length

277

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (73)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Coronary Syndrome	Associate	34382584
Adenocarcinoma of Lung	Associate	38204755
Adenocarcinoma of Lung	Stimulate	40776873
Alzheimer Disease	Stimulate	30507579
Anal Gland Neoplasms	Associate	36521659
Aortic Aneurysm Abdominal	Stimulate	29180197
Arthritis	Associate	26685054, 37958918, 9237673
Arthritis Psoriatic	Associate	11178946
Arthritis Rheumatoid	Associate	11178946, 12823853, 15549486, 21162099, 33897688, 34177888, 35353944
Arthritis Rheumatoid	Stimulate	37958839
Asthma	Associate	16873769
Bloom Syndrome	Associate	32073752
Carcinogenesis	Associate	1730767
Carcinoma Renal Cell	Associate	26831905, 28004769
Cerebral Amyloid Angiopathy	Associate	32993718
Chemical and Drug Induced Liver Injury	Associate	32317078
Cholangitis Sclerosing	Stimulate	17162367
Colorectal Neoplasms	Associate	19383344, 20846378, 25516661, 34294834
Contracture	Inhibit	21239672
Corneal Injuries	Associate	24501198
Crohn Disease	Associate	26339133
Diabetes Mellitus Type 1	Associate	37948519
Diabetic Foot	Associate	35013299
Dry Eye Syndromes	Inhibit	32829938
Eosinophilic Esophagitis	Associate	23503644, 37652141
Fatty Liver	Associate	37657050
Fibrocartilaginous embolism	Associate	33536009, 36578051
Fibrosis	Associate	30569148
Fibrosis	Inhibit	34382584, 37947592
Fistula	Associate	36521659
Glioblastoma	Associate	35766985
Glioma	Associate	38225203
Glomerulonephritis IGA	Associate	32938960
Head and Neck Neoplasms	Associate	34344926
Hypoxia	Stimulate	35457151
Infections	Stimulate	32047499
Infections	Associate	34382584
Inflammation	Associate	11287417, 15917224, 16124062, 16873769, 1730767, 21596748, 24403066, 24646687, 24677718, 25054223, 26685054, 28367002, 29129649, 31491901, 32484571 View all (10 more)
Inflammation	Inhibit	11854277, 22351758, 24501198, 31316502, 34526039, 35222359, 36581683, 37312421
Inflammation	Stimulate	31316519, 40776873
Intervertebral Disc Degeneration	Associate	33536009
Intervertebral Disc Degeneration	Stimulate	36578051
Intervertebral disc disease	Associate	15549486
Ischemic Stroke	Associate	35222359
Joint Diseases	Associate	11854277, 21162099
Kashin Beck Disease	Associate	32816579
Keloid	Associate	30569148
Kidney Diseases	Associate	32938960
Leukemic Infiltration	Associate	23503644
Liver Diseases	Associate	32317078
Malformations of Cortical Development Group I	Associate	35831906
Meningitis Bacterial	Associate	36119025
Mitochondrial Diseases	Associate	30569148
Multiple Sclerosis	Associate	32951330
Myocardial Infarction	Associate	24501198, 31772617
Nasopharyngeal Carcinoma	Stimulate	33564686
Neoplasms	Associate	37201873, 40247223
Neoplasms	Stimulate	38204755
Osteoarthritis	Associate	11178946, 11854277, 24894724, 25054223, 25575966, 29129649
Osteoarthritis	Inhibit	16139532
Osteoarthritis Knee	Associate	16453284
Ovarian Neoplasms	Stimulate	39972314
Polycystic Ovary Syndrome	Associate	25393639, 28004769
Prion Diseases	Associate	36581683
Reperfusion Injury	Associate	35831906
Rheumatic Diseases	Associate	31861245
Sepsis	Associate	31093495
Spondylitis Ankylosing	Inhibit	39185422
Stomach Neoplasms	Associate	35854776, 37201873
Tooth Erosion	Inhibit	21162099
Urinary Bladder Neoplasms	Associate	40247223
Urinary Bladder Neoplasms	Stimulate	40776873
Zika Virus Infection	Stimulate	33597462

TNFAIP6 (TNF alpha induced protein 6)