Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7128
Gene name	TNF alpha induced protein 3
Gene symbol	TNFAIP3
Synonyms (NCBI Gene)	A20AIFBL1AISBLOTUD7CTNFA1P2
Chromosome	6
Chromosome location	6q23.3
Summary	This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well a

Show/Hide all (9)

SNP ID	Visualize variation	Clinical significance	Consequence
rs864321625	T>A	Pathogenic	Stop gained, coding sequence variant
rs864321626	C>T	Pathogenic	Stop gained, coding sequence variant
rs864321682	T>-	Pathogenic	Frameshift variant, coding sequence variant
rs864321683	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs864321684	C>G	Pathogenic	Stop gained, coding sequence variant
rs864321685	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1064796470	CT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1554225021	T>C	Pathogenic	Missense variant, coding sequence variant
rs1582892979	GGAG>AGGAA	Pathogenic	Coding sequence variant, frameshift variant

469

Show/Hide all (469)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005955	hsa-miR-21-5p	Luciferase reporter assay	21131358
MIRT005955	hsa-miR-21-5p	Luciferase reporter assay	21131358
MIRT006380	hsa-miR-29a-3p	Luciferase reporter assay	21763284
MIRT006380	hsa-miR-29a-3p	Luciferase reporter assay	21763284
MIRT006471	hsa-miR-125a-5p	qRT-PCRWestern blot	22550173
MIRT006472	hsa-miR-125b-5p	qRT-PCRWestern blot	22550173
MIRT006380	hsa-miR-29a-3p	Luciferase reporter assay	21763284
MIRT006472	hsa-miR-125b-5p	qRT-PCRWestern blot	22550173
MIRT029863	hsa-miR-26b-5p	Microarray	19088304
MIRT030581	hsa-miR-24-3p	Microarray	19748357
MIRT621770	hsa-miR-5700	HITS-CLIP	23824327
MIRT621769	hsa-miR-2278	HITS-CLIP	23824327
MIRT621768	hsa-miR-586	HITS-CLIP	23824327
MIRT621767	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT621766	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT621765	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT621764	hsa-miR-520g-5p	HITS-CLIP	23824327
MIRT621763	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT621762	hsa-miR-518d-5p	HITS-CLIP	23824327
MIRT621761	hsa-miR-518e-5p	HITS-CLIP	23824327
MIRT621760	hsa-miR-518f-5p	HITS-CLIP	23824327
MIRT621759	hsa-miR-519a-5p	HITS-CLIP	23824327
MIRT621758	hsa-miR-519b-5p	HITS-CLIP	23824327
MIRT621757	hsa-miR-519c-5p	HITS-CLIP	23824327
MIRT621756	hsa-miR-520c-5p	HITS-CLIP	23824327
MIRT621755	hsa-miR-522-5p	HITS-CLIP	23824327
MIRT621754	hsa-miR-523-5p	HITS-CLIP	23824327
MIRT621753	hsa-miR-526a	HITS-CLIP	23824327
MIRT621752	hsa-miR-4777-5p	HITS-CLIP	23824327
MIRT621751	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT621750	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621749	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621748	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT621770	hsa-miR-5700	HITS-CLIP	23824327
MIRT621769	hsa-miR-2278	HITS-CLIP	23824327
MIRT621768	hsa-miR-586	HITS-CLIP	23824327
MIRT621767	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT621766	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT621765	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT621764	hsa-miR-520g-5p	HITS-CLIP	23824327
MIRT621763	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT621762	hsa-miR-518d-5p	HITS-CLIP	23824327
MIRT621761	hsa-miR-518e-5p	HITS-CLIP	23824327
MIRT621760	hsa-miR-518f-5p	HITS-CLIP	23824327
MIRT621759	hsa-miR-519a-5p	HITS-CLIP	23824327
MIRT621758	hsa-miR-519b-5p	HITS-CLIP	23824327
MIRT621757	hsa-miR-519c-5p	HITS-CLIP	23824327
MIRT621756	hsa-miR-520c-5p	HITS-CLIP	23824327
MIRT621755	hsa-miR-522-5p	HITS-CLIP	23824327
MIRT621754	hsa-miR-523-5p	HITS-CLIP	23824327
MIRT621753	hsa-miR-526a	HITS-CLIP	23824327
MIRT621752	hsa-miR-4777-5p	HITS-CLIP	23824327
MIRT621751	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT621750	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621749	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621748	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT621770	hsa-miR-5700	HITS-CLIP	23824327
MIRT621769	hsa-miR-2278	HITS-CLIP	23824327
MIRT621768	hsa-miR-586	HITS-CLIP	23824327
MIRT621767	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT621766	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT621765	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT621764	hsa-miR-520g-5p	HITS-CLIP	23824327
MIRT621763	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT621762	hsa-miR-518d-5p	HITS-CLIP	23824327
MIRT621761	hsa-miR-518e-5p	HITS-CLIP	23824327
MIRT621760	hsa-miR-518f-5p	HITS-CLIP	23824327
MIRT621759	hsa-miR-519a-5p	HITS-CLIP	23824327
MIRT621758	hsa-miR-519b-5p	HITS-CLIP	23824327
MIRT621757	hsa-miR-519c-5p	HITS-CLIP	23824327
MIRT621756	hsa-miR-520c-5p	HITS-CLIP	23824327
MIRT621755	hsa-miR-522-5p	HITS-CLIP	23824327
MIRT621754	hsa-miR-523-5p	HITS-CLIP	23824327
MIRT621753	hsa-miR-526a	HITS-CLIP	23824327
MIRT621752	hsa-miR-4777-5p	HITS-CLIP	23824327
MIRT621751	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT621750	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621749	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621748	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT553493	hsa-miR-23c	PAR-CLIP	21572407
MIRT553492	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT553491	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT553490	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT553489	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT553488	hsa-miR-580-5p	PAR-CLIP	21572407
MIRT553487	hsa-miR-3688-3p	PAR-CLIP	21572407
MIRT553486	hsa-miR-5093	PAR-CLIP	21572407
MIRT553485	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT553484	hsa-miR-505-3p	PAR-CLIP	21572407
MIRT553483	hsa-miR-3658	PAR-CLIP	21572407
MIRT553482	hsa-miR-5096	PAR-CLIP	21572407
MIRT553481	hsa-miR-335-3p	PAR-CLIP	21572407
MIRT448422	hsa-miR-5692a	PAR-CLIP	22100165
MIRT450585	hsa-miR-141-5p	PAR-CLIP	22100165
MIRT448421	hsa-miR-412-3p	PAR-CLIP	22100165
MIRT448420	hsa-miR-6754-3p	PAR-CLIP	22100165
MIRT448419	hsa-miR-6837-3p	PAR-CLIP	22100165
MIRT448406	hsa-miR-4635	PAR-CLIP	22100165
MIRT448418	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT448417	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT448416	hsa-miR-573	PAR-CLIP	22100165
MIRT448422	hsa-miR-5692a	PAR-CLIP	22100165
MIRT448421	hsa-miR-412-3p	PAR-CLIP	22100165
MIRT448420	hsa-miR-6754-3p	PAR-CLIP	22100165
MIRT448419	hsa-miR-6837-3p	PAR-CLIP	22100165
MIRT448418	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT448417	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT448416	hsa-miR-573	PAR-CLIP	22100165
MIRT448415	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT448414	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT448413	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT448412	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT448411	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT448410	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT448409	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT448408	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT448407	hsa-miR-4729	PAR-CLIP	22100165
MIRT448406	hsa-miR-4635	PAR-CLIP	22100165
MIRT448405	hsa-miR-3185	PAR-CLIP	22100165
MIRT448403	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT439414	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT726266	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT726265	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT439414	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT006472	hsa-miR-125b-5p	Luciferase reporter assayqRT-PCRWestern blot	27637078
MIRT006472	hsa-miR-125b-5p	Luciferase reporter assayqRT-PCRWestern blot	27637078
MIRT726265	hsa-miR-19b-3p	Luciferase reporter assayqRT-PCRWestern blot	27919278
MIRT726265	hsa-miR-19b-3p	Luciferase reporter assayqRT-PCRWestern blot	27919278
MIRT726266	hsa-miR-19a-3p	Luciferase reporter assayqRT-PCRWestern blot	26367773
MIRT006471	hsa-miR-125a-5p	Luciferase reporter assayqRT-PCRWestern blot	26758190
MIRT006471	hsa-miR-125a-5p	Luciferase reporter assayqRT-PCRWestern blot	26758190
MIRT006472	hsa-miR-125b-5p	qRT-PCR	32039213
MIRT553490	hsa-miR-23a-3p	Luciferase reporter assayWestern blottingRNA-seqqRT-PCR	34201504
MIRT736719	hsa-miR-605-5p	Luciferase reporter assayWestern blottingqRT-PCR	31452243
MIRT621770	hsa-miR-5700	HITS-CLIP	23824327
MIRT621769	hsa-miR-2278	HITS-CLIP	23824327
MIRT621768	hsa-miR-586	HITS-CLIP	23824327
MIRT621767	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT621766	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT621765	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT621764	hsa-miR-520g-5p	HITS-CLIP	23824327
MIRT621763	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT621762	hsa-miR-518d-5p	HITS-CLIP	23824327
MIRT621761	hsa-miR-518e-5p	HITS-CLIP	23824327
MIRT621760	hsa-miR-518f-5p	HITS-CLIP	23824327
MIRT621759	hsa-miR-519a-5p	HITS-CLIP	23824327
MIRT621758	hsa-miR-519b-5p	HITS-CLIP	23824327
MIRT621757	hsa-miR-519c-5p	HITS-CLIP	23824327
MIRT621756	hsa-miR-520c-5p	HITS-CLIP	23824327
MIRT621755	hsa-miR-522-5p	HITS-CLIP	23824327
MIRT621754	hsa-miR-523-5p	HITS-CLIP	23824327
MIRT621753	hsa-miR-526a	HITS-CLIP	23824327
MIRT621752	hsa-miR-4777-5p	HITS-CLIP	23824327
MIRT621751	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT621750	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621749	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621748	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT621770	hsa-miR-5700	HITS-CLIP	23824327
MIRT621769	hsa-miR-2278	HITS-CLIP	23824327
MIRT621768	hsa-miR-586	HITS-CLIP	23824327
MIRT621767	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT621766	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT621765	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT621764	hsa-miR-520g-5p	HITS-CLIP	23824327
MIRT621763	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT621762	hsa-miR-518d-5p	HITS-CLIP	23824327
MIRT621761	hsa-miR-518e-5p	HITS-CLIP	23824327
MIRT621760	hsa-miR-518f-5p	HITS-CLIP	23824327
MIRT621759	hsa-miR-519a-5p	HITS-CLIP	23824327
MIRT621758	hsa-miR-519b-5p	HITS-CLIP	23824327
MIRT621757	hsa-miR-519c-5p	HITS-CLIP	23824327
MIRT621756	hsa-miR-520c-5p	HITS-CLIP	23824327
MIRT621755	hsa-miR-522-5p	HITS-CLIP	23824327
MIRT621754	hsa-miR-523-5p	HITS-CLIP	23824327
MIRT621753	hsa-miR-526a	HITS-CLIP	23824327
MIRT621752	hsa-miR-4777-5p	HITS-CLIP	23824327
MIRT621751	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT621750	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621749	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621748	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT621770	hsa-miR-5700	HITS-CLIP	23824327
MIRT621769	hsa-miR-2278	HITS-CLIP	23824327
MIRT621768	hsa-miR-586	HITS-CLIP	23824327
MIRT621767	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT621766	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT621765	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT621764	hsa-miR-520g-5p	HITS-CLIP	23824327
MIRT621763	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT621762	hsa-miR-518d-5p	HITS-CLIP	23824327
MIRT621761	hsa-miR-518e-5p	HITS-CLIP	23824327
MIRT621760	hsa-miR-518f-5p	HITS-CLIP	23824327
MIRT621759	hsa-miR-519a-5p	HITS-CLIP	23824327
MIRT621758	hsa-miR-519b-5p	HITS-CLIP	23824327
MIRT621757	hsa-miR-519c-5p	HITS-CLIP	23824327
MIRT621756	hsa-miR-520c-5p	HITS-CLIP	23824327
MIRT621755	hsa-miR-522-5p	HITS-CLIP	23824327
MIRT621754	hsa-miR-523-5p	HITS-CLIP	23824327
MIRT621753	hsa-miR-526a	HITS-CLIP	23824327
MIRT621752	hsa-miR-4777-5p	HITS-CLIP	23824327
MIRT621751	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT621750	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621749	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621748	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT553493	hsa-miR-23c	PAR-CLIP	21572407
MIRT553492	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT553491	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT553490	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT553489	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT553488	hsa-miR-580-5p	PAR-CLIP	21572407
MIRT553487	hsa-miR-3688-3p	PAR-CLIP	21572407
MIRT553486	hsa-miR-5093	PAR-CLIP	21572407
MIRT553485	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT553484	hsa-miR-505-3p	PAR-CLIP	21572407
MIRT553483	hsa-miR-3658	PAR-CLIP	21572407
MIRT553482	hsa-miR-5096	PAR-CLIP	21572407
MIRT553481	hsa-miR-335-3p	PAR-CLIP	21572407
MIRT448422	hsa-miR-5692a	PAR-CLIP	22100165
MIRT450585	hsa-miR-141-5p	PAR-CLIP	22100165
MIRT448421	hsa-miR-412-3p	PAR-CLIP	22100165
MIRT448420	hsa-miR-6754-3p	PAR-CLIP	22100165
MIRT448419	hsa-miR-6837-3p	PAR-CLIP	22100165
MIRT448406	hsa-miR-4635	PAR-CLIP	22100165
MIRT448418	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT448417	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT448416	hsa-miR-573	PAR-CLIP	22100165
MIRT448422	hsa-miR-5692a	PAR-CLIP	22100165
MIRT448421	hsa-miR-412-3p	PAR-CLIP	22100165
MIRT448420	hsa-miR-6754-3p	PAR-CLIP	22100165
MIRT448419	hsa-miR-6837-3p	PAR-CLIP	22100165
MIRT448418	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT448417	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT448416	hsa-miR-573	PAR-CLIP	22100165
MIRT448415	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT448414	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT448413	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT448412	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT448411	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT448410	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT448409	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT448408	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT448407	hsa-miR-4729	PAR-CLIP	22100165
MIRT448406	hsa-miR-4635	PAR-CLIP	22100165
MIRT448405	hsa-miR-3185	PAR-CLIP	22100165
MIRT448403	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT1442249	hsa-miR-1208	CLIP-seq
MIRT1442250	hsa-miR-1238	CLIP-seq
MIRT1442251	hsa-miR-1324	CLIP-seq
MIRT1442252	hsa-miR-186	CLIP-seq
MIRT1442253	hsa-miR-193a-3p	CLIP-seq
MIRT1442254	hsa-miR-193b	CLIP-seq
MIRT1442255	hsa-miR-1976	CLIP-seq
MIRT1442256	hsa-miR-3065-5p	CLIP-seq
MIRT1442257	hsa-miR-3119	CLIP-seq
MIRT1442258	hsa-miR-3124-3p	CLIP-seq
MIRT1442259	hsa-miR-3140-3p	CLIP-seq
MIRT1442260	hsa-miR-3160-5p	CLIP-seq
MIRT1442261	hsa-miR-3183	CLIP-seq
MIRT1442262	hsa-miR-3184	CLIP-seq
MIRT1442263	hsa-miR-370	CLIP-seq
MIRT1442264	hsa-miR-3914	CLIP-seq
MIRT1442265	hsa-miR-409-5p	CLIP-seq
MIRT1442266	hsa-miR-423-5p	CLIP-seq
MIRT1442267	hsa-miR-4257	CLIP-seq
MIRT1442268	hsa-miR-4519	CLIP-seq
MIRT1442269	hsa-miR-4684-3p	CLIP-seq
MIRT1442270	hsa-miR-4723-3p	CLIP-seq
MIRT1442271	hsa-miR-4736	CLIP-seq
MIRT1442272	hsa-miR-4797-5p	CLIP-seq
MIRT1442273	hsa-miR-491-3p	CLIP-seq
MIRT1442274	hsa-miR-563	CLIP-seq
MIRT1442275	hsa-miR-626	CLIP-seq
MIRT1442276	hsa-miR-767-3p	CLIP-seq
MIRT1442277	hsa-miR-873	CLIP-seq
MIRT1442278	hsa-miR-885-3p	CLIP-seq
MIRT1442279	hsa-miR-892b	CLIP-seq
MIRT1555049	hsa-miR-18a	CLIP-seq
MIRT1555050	hsa-miR-18b	CLIP-seq
MIRT1555051	hsa-miR-4735-3p	CLIP-seq
MIRT1555052	hsa-miR-4735-5p	CLIP-seq
MIRT1555053	hsa-miR-4775	CLIP-seq
MIRT1555054	hsa-miR-576-5p	CLIP-seq
MIRT1555055	hsa-miR-590-3p	CLIP-seq
MIRT2132408	hsa-miR-1237	CLIP-seq
MIRT2132409	hsa-miR-1248	CLIP-seq
MIRT2132410	hsa-miR-1343	CLIP-seq
MIRT1555049	hsa-miR-18a	CLIP-seq
MIRT1555050	hsa-miR-18b	CLIP-seq
MIRT2132411	hsa-miR-3074-5p	CLIP-seq
MIRT1442258	hsa-miR-3124-3p	CLIP-seq
MIRT2132412	hsa-miR-3150a-3p	CLIP-seq
MIRT2132413	hsa-miR-3175	CLIP-seq
MIRT2132414	hsa-miR-376c	CLIP-seq
MIRT2132415	hsa-miR-4667-5p	CLIP-seq
MIRT2132416	hsa-miR-4700-5p	CLIP-seq
MIRT1555051	hsa-miR-4735-3p	CLIP-seq
MIRT1555052	hsa-miR-4735-5p	CLIP-seq
MIRT1555053	hsa-miR-4775	CLIP-seq
MIRT2132417	hsa-miR-548aa	CLIP-seq
MIRT2132418	hsa-miR-556-3p	CLIP-seq
MIRT1555054	hsa-miR-576-5p	CLIP-seq
MIRT1555055	hsa-miR-590-3p	CLIP-seq
MIRT2132419	hsa-miR-939	CLIP-seq
MIRT2353440	hsa-miR-128	CLIP-seq
MIRT2353441	hsa-miR-27a	CLIP-seq
MIRT2353442	hsa-miR-27b	CLIP-seq
MIRT1442267	hsa-miR-4257	CLIP-seq
MIRT2353443	hsa-miR-455-3p	CLIP-seq
MIRT1442272	hsa-miR-4797-5p	CLIP-seq
MIRT2396097	hsa-miR-4446-5p	CLIP-seq
MIRT2396098	hsa-miR-4755-5p	CLIP-seq
MIRT2441399	hsa-miR-1202	CLIP-seq
MIRT2441400	hsa-miR-1265	CLIP-seq
MIRT2441401	hsa-miR-1266	CLIP-seq
MIRT2441402	hsa-miR-1286	CLIP-seq
MIRT2441403	hsa-miR-141	CLIP-seq
MIRT2441404	hsa-miR-188-5p	CLIP-seq
MIRT2441405	hsa-miR-200a	CLIP-seq
MIRT2441406	hsa-miR-2117	CLIP-seq
MIRT2441407	hsa-miR-2277-3p	CLIP-seq
MIRT2441408	hsa-miR-330-3p	CLIP-seq
MIRT2441409	hsa-miR-3664-3p	CLIP-seq
MIRT2441410	hsa-miR-3688-5p	CLIP-seq
MIRT2441411	hsa-miR-3689d	CLIP-seq
MIRT2441412	hsa-miR-3913-3p	CLIP-seq
MIRT2441413	hsa-miR-3972	CLIP-seq
MIRT2441414	hsa-miR-4273	CLIP-seq
MIRT2441415	hsa-miR-4286	CLIP-seq
MIRT2441416	hsa-miR-4318	CLIP-seq
MIRT2441417	hsa-miR-4433	CLIP-seq
MIRT2396097	hsa-miR-4446-5p	CLIP-seq
MIRT2441418	hsa-miR-4459	CLIP-seq
MIRT2441419	hsa-miR-4518	CLIP-seq
MIRT2441420	hsa-miR-4722-5p	CLIP-seq
MIRT2441421	hsa-miR-4753-5p	CLIP-seq
MIRT2441422	hsa-miR-4758-3p	CLIP-seq
MIRT2441423	hsa-miR-4768-3p	CLIP-seq
MIRT2441424	hsa-miR-4768-5p	CLIP-seq
MIRT2441425	hsa-miR-4780	CLIP-seq
MIRT2441426	hsa-miR-489	CLIP-seq
MIRT2441427	hsa-miR-623	CLIP-seq
MIRT2441428	hsa-miR-888	CLIP-seq
MIRT2441429	hsa-miR-935	CLIP-seq
MIRT2647426	hsa-let-7a	CLIP-seq
MIRT2647427	hsa-let-7b	CLIP-seq
MIRT2647428	hsa-let-7c	CLIP-seq
MIRT2647429	hsa-let-7d	CLIP-seq
MIRT2647430	hsa-let-7e	CLIP-seq
MIRT2647431	hsa-let-7f	CLIP-seq
MIRT2647432	hsa-let-7g	CLIP-seq
MIRT2647433	hsa-let-7i	CLIP-seq
MIRT2441399	hsa-miR-1202	CLIP-seq
MIRT2647434	hsa-miR-1207-3p	CLIP-seq
MIRT2647435	hsa-miR-1256	CLIP-seq
MIRT2441400	hsa-miR-1265	CLIP-seq
MIRT2441401	hsa-miR-1266	CLIP-seq
MIRT2441403	hsa-miR-141	CLIP-seq
MIRT2441404	hsa-miR-188-5p	CLIP-seq
MIRT2441405	hsa-miR-200a	CLIP-seq
MIRT2647436	hsa-miR-204	CLIP-seq
MIRT2647437	hsa-miR-211	CLIP-seq
MIRT2647438	hsa-miR-2110	CLIP-seq
MIRT2441406	hsa-miR-2117	CLIP-seq
MIRT2647439	hsa-miR-2355-5p	CLIP-seq
MIRT2647440	hsa-miR-3160-3p	CLIP-seq
MIRT1442260	hsa-miR-3160-5p	CLIP-seq
MIRT2647441	hsa-miR-3173-3p	CLIP-seq
MIRT2647442	hsa-miR-326	CLIP-seq
MIRT2441408	hsa-miR-330-3p	CLIP-seq
MIRT2647443	hsa-miR-330-5p	CLIP-seq
MIRT2647444	hsa-miR-3647-5p	CLIP-seq
MIRT2441409	hsa-miR-3664-3p	CLIP-seq
MIRT2647445	hsa-miR-3675-3p	CLIP-seq
MIRT2441410	hsa-miR-3688-5p	CLIP-seq
MIRT2647446	hsa-miR-3714	CLIP-seq
MIRT2441412	hsa-miR-3913-3p	CLIP-seq
MIRT2647447	hsa-miR-3941	CLIP-seq
MIRT2441413	hsa-miR-3972	CLIP-seq
MIRT2647448	hsa-miR-412	CLIP-seq
MIRT2647449	hsa-miR-4263	CLIP-seq
MIRT2647450	hsa-miR-4271	CLIP-seq
MIRT2441414	hsa-miR-4273	CLIP-seq
MIRT2647451	hsa-miR-4287	CLIP-seq
MIRT2441416	hsa-miR-4318	CLIP-seq
MIRT2441417	hsa-miR-4433	CLIP-seq
MIRT2396097	hsa-miR-4446-5p	CLIP-seq
MIRT2647452	hsa-miR-4458	CLIP-seq
MIRT2441418	hsa-miR-4459	CLIP-seq
MIRT2647453	hsa-miR-4500	CLIP-seq
MIRT2441419	hsa-miR-4518	CLIP-seq
MIRT1442268	hsa-miR-4519	CLIP-seq
MIRT2647454	hsa-miR-4521	CLIP-seq
MIRT2647455	hsa-miR-466	CLIP-seq
MIRT2132415	hsa-miR-4667-5p	CLIP-seq
MIRT2647456	hsa-miR-4668-5p	CLIP-seq
MIRT2647457	hsa-miR-4672	CLIP-seq
MIRT2647458	hsa-miR-4685-3p	CLIP-seq
MIRT2647459	hsa-miR-4698	CLIP-seq
MIRT2132416	hsa-miR-4700-5p	CLIP-seq
MIRT2647460	hsa-miR-4717-5p	CLIP-seq
MIRT2647461	hsa-miR-4725-3p	CLIP-seq
MIRT2647462	hsa-miR-4731-3p	CLIP-seq
MIRT2441421	hsa-miR-4753-5p	CLIP-seq
MIRT2647463	hsa-miR-4759	CLIP-seq
MIRT2441423	hsa-miR-4768-3p	CLIP-seq
MIRT2441424	hsa-miR-4768-5p	CLIP-seq
MIRT2441425	hsa-miR-4780	CLIP-seq
MIRT2647464	hsa-miR-4789-5p	CLIP-seq
MIRT2647465	hsa-miR-4801	CLIP-seq
MIRT2441426	hsa-miR-489	CLIP-seq
MIRT1442273	hsa-miR-491-3p	CLIP-seq
MIRT2647466	hsa-miR-515-5p	CLIP-seq
MIRT2647467	hsa-miR-548an	CLIP-seq
MIRT1442274	hsa-miR-563	CLIP-seq
MIRT1555054	hsa-miR-576-5p	CLIP-seq
MIRT2441427	hsa-miR-623	CLIP-seq
MIRT2647468	hsa-miR-637	CLIP-seq
MIRT1442278	hsa-miR-885-3p	CLIP-seq
MIRT2441428	hsa-miR-888	CLIP-seq
MIRT2441429	hsa-miR-935	CLIP-seq
MIRT2647469	hsa-miR-98	CLIP-seq
MIRT2441399	hsa-miR-1202	CLIP-seq
MIRT2647435	hsa-miR-1256	CLIP-seq
MIRT2441400	hsa-miR-1265	CLIP-seq
MIRT2441401	hsa-miR-1266	CLIP-seq
MIRT2693653	hsa-miR-1292	CLIP-seq
MIRT2441403	hsa-miR-141	CLIP-seq
MIRT2441404	hsa-miR-188-5p	CLIP-seq
MIRT2441405	hsa-miR-200a	CLIP-seq
MIRT2647438	hsa-miR-2110	CLIP-seq
MIRT2441406	hsa-miR-2117	CLIP-seq
MIRT2647439	hsa-miR-2355-5p	CLIP-seq
MIRT2647440	hsa-miR-3160-3p	CLIP-seq
MIRT1442260	hsa-miR-3160-5p	CLIP-seq
MIRT2647442	hsa-miR-326	CLIP-seq
MIRT2441408	hsa-miR-330-3p	CLIP-seq
MIRT2647443	hsa-miR-330-5p	CLIP-seq
MIRT2441409	hsa-miR-3664-3p	CLIP-seq
MIRT2647445	hsa-miR-3675-3p	CLIP-seq
MIRT2441410	hsa-miR-3688-5p	CLIP-seq
MIRT2441412	hsa-miR-3913-3p	CLIP-seq
MIRT2441413	hsa-miR-3972	CLIP-seq
MIRT2647449	hsa-miR-4263	CLIP-seq
MIRT2647450	hsa-miR-4271	CLIP-seq
MIRT2441414	hsa-miR-4273	CLIP-seq
MIRT2441416	hsa-miR-4318	CLIP-seq
MIRT2441417	hsa-miR-4433	CLIP-seq
MIRT2396097	hsa-miR-4446-5p	CLIP-seq
MIRT2441418	hsa-miR-4459	CLIP-seq
MIRT2693654	hsa-miR-4471	CLIP-seq
MIRT2441419	hsa-miR-4518	CLIP-seq
MIRT2647454	hsa-miR-4521	CLIP-seq
MIRT2693655	hsa-miR-4646-5p	CLIP-seq
MIRT2132415	hsa-miR-4667-5p	CLIP-seq
MIRT2647456	hsa-miR-4668-5p	CLIP-seq
MIRT2647459	hsa-miR-4698	CLIP-seq
MIRT2132416	hsa-miR-4700-5p	CLIP-seq
MIRT2647460	hsa-miR-4717-5p	CLIP-seq
MIRT2647461	hsa-miR-4725-3p	CLIP-seq
MIRT2441421	hsa-miR-4753-5p	CLIP-seq
MIRT2441423	hsa-miR-4768-3p	CLIP-seq
MIRT2441424	hsa-miR-4768-5p	CLIP-seq
MIRT2441425	hsa-miR-4780	CLIP-seq
MIRT2441426	hsa-miR-489	CLIP-seq
MIRT1555054	hsa-miR-576-5p	CLIP-seq
MIRT2441427	hsa-miR-623	CLIP-seq
MIRT2647468	hsa-miR-637	CLIP-seq
MIRT1442278	hsa-miR-885-3p	CLIP-seq
MIRT2441428	hsa-miR-888	CLIP-seq
MIRT2441429	hsa-miR-935	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
NFKB1	Activation	11880364;19343319
NFKB1	Unknown	10807933
PML	Repression	12080044
REL	Activation	11880364
RELA	Activation	11880364;19343319
RELA	Unknown	10807933

100

Show/Hide all (100)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001922	Process	B-1 B cell homeostasis	IEA
GO:0001922	Process	B-1 B cell homeostasis	ISS
GO:0002020	Function	Protease binding	IPI	18223652
GO:0002237	Process	Response to molecule of bacterial origin	IDA	19912257
GO:0002237	Process	Response to molecule of bacterial origin	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002634	Process	Regulation of germinal center formation	IEA
GO:0002634	Process	Regulation of germinal center formation	ISS
GO:0002677	Process	Negative regulation of chronic inflammatory response	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	15258597
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	15258597, 23827681
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IMP	15258597
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS	20392859
GO:0005515	Function	Protein binding	IPI	9299557, 11463333, 15142865, 15169888, 15231748, 15474016, 19060883, 19131965, 20392859, 20936779, 21988832, 23032186, 25416956, 30561431, 31015422, 31515488, 32296183, 33961781, 36931259
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11463333
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007010	Process	Cytoskeleton organization	IBA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	TAS
GO:0016477	Process	Cell migration	IBA
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS	20392859
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0019900	Function	Kinase binding	IEA
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IBA
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	20392859
GO:0032495	Process	Response to muramyl dipeptide	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IMP	28094437
GO:0032703	Process	Negative regulation of interleukin-2 production	IMP	18223652
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	ISS
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	ISS
GO:0034136	Process	Negative regulation of toll-like receptor 2 signaling pathway	NAS	15142865
GO:0034140	Process	Negative regulation of toll-like receptor 3 signaling pathway	IDA	15474016
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	NAS	15142865
GO:0034148	Process	Negative regulation of toll-like receptor 5 signaling pathway	IEA
GO:0035871	Process	Protein K11-linked deubiquitination	IDA	23827681
GO:0035872	Process	Nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway	TAS
GO:0039532	Process	Negative regulation of cytoplasmic pattern recognition receptor signaling pathway	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 25502805, 30561431, 31515488, 32296183
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	11463333, 15258597, 18223652, 21127049
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0043130	Function	Ubiquitin binding	IPI	19285159
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	21127049
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0045779	Process	Negative regulation of bone resorption	NAS	21127049
GO:0045824	Process	Negative regulation of innate immune response	IEA
GO:0045824	Process	Negative regulation of innate immune response	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	16816117
GO:0050691	Process	Regulation of defense response to virus by host	NAS	15142865
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0050869	Process	Negative regulation of B cell activation	IEA
GO:0050869	Process	Negative regulation of B cell activation	ISS
GO:0061043	Process	Regulation of vascular wound healing	NAS	16816117
GO:0061578	Function	K63-linked deubiquitinase activity	EXP	14748687
GO:0061578	Function	K63-linked deubiquitinase activity	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	ISS
GO:0070429	Process	Negative regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA
GO:0070433	Process	Negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway	IEA
GO:0070530	Function	K63-linked polyubiquitin modification-dependent protein binding	IBA
GO:0070536	Process	Protein K63-linked deubiquitination	IDA	15258597
GO:0070536	Process	Protein K63-linked deubiquitination	IEA
GO:0070536	Process	Protein K63-linked deubiquitination	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	15258597
GO:0071108	Process	Protein K48-linked deubiquitination	IDA	23827681
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	19912257, 21127049, 21220427
GO:0071947	Process	Protein deubiquitination involved in ubiquitin-dependent protein catabolic process	IBA
GO:0072573	Process	Tolerance induction to lipopolysaccharide	IMP	21220427
GO:0072666	Process	Establishment of protein localization to vacuole	IEA
GO:0090291	Process	Negative regulation of osteoclast proliferation	NAS	21127049
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	12167698
GO:2000347	Process	Positive regulation of hepatocyte proliferation	IEA
GO:2000349	Process	Negative regulation of CD40 signaling pathway	IMP	12885753
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	12885753
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
191163	11896	ENSG00000118503

P21580

Protein name

Tumor necrosis factor alpha-induced protein 3 (TNF alpha-induced protein 3) (EC 2.3.2.-) (EC 3.4.19.12) (OTU domain-containing protein 7C) (Putative DNA-binding protein A20) (Zinc finger protein A20) [Cleaved into: A20p50; A20p37]

Protein function

Ubiquitin-editing enzyme that contains both ubiquitin ligase and deubiquitinase activities. Involved in immune and inflammatory responses signaled by cytokines, such as TNF-alpha and IL-1 beta, or pathogens via Toll-like receptors (TLRs) through

PDB

2EQE , 2EQF , 2EQG , 2VFJ , 3DKB , 3OJ3 , 3OJ4 , 3VUW , 3VUX , 3VUY , 3ZJD , 3ZJE , 3ZJF , 3ZJG , 5LRX , 5V3B , 5V3P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02338	OTU	98 → 257	OTU-like cysteine protease	Family
PF01754	zf-A20	385 → 409	A20-like zinc finger	Family
PF01754	zf-A20	476 → 500	A20-like zinc finger	Family
PF01754	zf-A20	655 → 678	A20-like zinc finger	Family
PF01754	zf-A20	760 → 784	A20-like zinc finger	Family

Sequence

MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQF
REIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDL
VLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTP
MARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPA
QECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKE
KLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENS
EQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPK
LNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRS
PGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCF
KRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGD
RTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGR
ECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARAS
CKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCN
ECFQFKQMYG

Sequence length

790

Interactions

View interactions

	KEGG		Reactome
	NF-kappa B signaling pathway Necroptosis NOD-like receptor signaling pathway IL-17 signaling pathway TNF signaling pathway Measles Epstein-Barr virus infection		NOD1/2 Signaling Pathway TNFR1-induced proapoptotic signaling Regulation of TNFR1 signaling TNFR1-induced NFkappaB signaling pathway Ovarian tumor domain proteases Negative regulators of DDX58/IFIH1 signaling

124

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autoinflammatory syndrome, familial, Behcet-like	Likely pathogenic; Pathogenic	rs1461832435, rs2114504458, rs2114496422, rs2114490906	RCV001329556 RCV001814603 RCV002244082 RCV003336786
Autoinflammatory syndrome, familial, Behcet-like 1	Likely pathogenic; Pathogenic	rs2114501370, rs1423560438, rs2114499761, rs2114500822, rs752539001, rs370705859, rs2482743566, rs864321625, rs864321682, rs864321626, rs864321684, rs864321685, rs2482750192, rs2482727350, rs1776278098	RCV003147678 RCV003229628 RCV002508822 RCV002508823 RCV002283900 RCV002306235 RCV005863752 RCV002508765 RCV002508766 RCV002508767 RCV002508769 RCV002508770 RCV003224748 RCV003325259 RCV002508792

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
A20 haploinsufficiency	Benign; Likely benign	rs376205580, rs141807543	RCV002466435 RCV002466436
Acute myeloid leukemia	Benign	rs5029947	RCV005905121
Cervical cancer	Benign	rs5029947	RCV005905123
Gastric cancer	Uncertain significance; Benign	rs1409953541, rs5029947	RCV005920714 RCV005905124
Lung cancer	Benign	rs5029947	RCV005905126
Malignant tumor of esophagus	Benign	rs5029947	RCV005905122
Ovarian serous cystadenocarcinoma	Likely benign	rs2114515181	RCV005934620
See cases	Uncertain significance	rs750716064, rs370381369	RCV003985523 RCV003128562
Thymoma	Benign	rs5029947	RCV005905125
TNFAIP3-related disorder	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign	rs1356553444, rs143002189, rs142752989, rs564646155, rs150355046, rs867703039, rs565804696, rs369155845, rs140120540, rs190199205, rs2114517667, rs1178336615, rs201600532, rs2114484581, rs2482766723 View all (6 more)	RCV003416186 RCV003953768 RCV003407525 RCV003407526 RCV003965029 RCV004749830 RCV003923762 RCV004749857 RCV003958736 RCV004750275 RCV003420556 RCV003395492 RCV003400142 RCV003901293 RCV003983477 RCV003901651 RCV003902019 RCV003941614 RCV003982146 RCV003971570 RCV003975552 RCV003910647
Uterine corpus endometrial carcinoma	Conflicting classifications of pathogenicity; Benign	rs5029941, rs5029947	RCV005890466 RCV005905127

Show/Hide Text Mining Associations (207)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acne Vulgaris	Stimulate	33241420
Acute Lung Injury	Associate	38071255
Acute On Chronic Liver Failure	Stimulate	26426612
Adenocarcinoma of Lung	Associate	40682067
Adenoma	Stimulate	24099634
Adenomatous Polyposis Coli	Associate	24099634
Agammaglobulinemia	Associate	33679772
Anemia	Associate	37535999
Anemia Pernicious	Associate	33966343
Arthralgia	Associate	33966343
Arthritis	Associate	22087647, 25683200, 37535999
Arthritis Juvenile	Associate	19565500, 19674979
Arthritis Psoriatic	Associate	22298274, 23054742, 31120955
Arthritis Psoriatic	Inhibit	37893484, 39991156
Arthritis Rheumatoid	Associate	17982455, 17982456, 19165918, 19292917, 19366996, 19417005, 19439038, 19445664, 19503088, 20112363, 20353580, 20483768, 20822710, 20849588, 20852893 View all (10 more)
Arthritis Rheumatoid	Inhibit	25683200
Asthma	Associate	18774390, 22694930
Asthma	Inhibit	38373824
Autoimmune Diseases	Associate	19565500, 20483768, 20854658, 21326317, 23944604, 24159176, 25806576, 26821284, 28448618, 29940800, 31138864, 31534975, 32231389, 33966343, 34030699, 35154120 View all (1 more)
Autoimmune Diseases	Inhibit	31206174
Behcet Syndrome	Associate	26642243, 26890122, 31164164, 31376265, 32719680, 33966343, 33971891, 34011076, 34030699, 34808442, 35154120, 37324276
Bipolar Disorder	Associate	25172408
Bone Resorption	Associate	21127049
Brain Diseases	Associate	33051914
Breast Neoplasms	Inhibit	24833255
Breast Neoplasms	Associate	29716623
Carcinogenesis	Associate	26485275
Carcinoma Hepatocellular	Associate	26783726, 29033545
Carcinoma Ovarian Epithelial	Associate	34071938
Carcinoma Pancreatic Ductal	Associate	33578593, 36596765
CD59 Deficiency	Associate	25397881
Celiac Disease	Associate	20483768
Cerebral Hemorrhage	Associate	36064566
Cerebral Infarction	Associate	26592822, 32164735, 35856366
Cholangiocarcinoma	Associate	26485275
Chronic Disease	Associate	22117534
Colitis Ulcerative	Associate	20176734, 26062845, 28842689
Colonic Diseases	Associate	37535999
Colonic Neoplasms	Inhibit	29718933
Colonic Polyps	Associate	24099634
Colorectal Neoplasms	Associate	22843550, 29807108, 32671985, 36033828, 36129143
Colorectal Neoplasms	Stimulate	24099634
Colorectal Neoplasms	Inhibit	28842689
Common Variable Immunodeficiency	Associate	32047491
Coronary Artery Disease	Associate	20483768, 32164735
Coronavirus Infections	Associate	34176764
Crohn Disease	Associate	21326317, 36746519
Crohn Disease	Inhibit	25956706
Cryptorchidism	Stimulate	18687424
Cystic Fibrosis	Inhibit	27286825
Death	Associate	37839544
Delayed Cranial Ossification due to CBFB Haploinsufficiency	Associate	31164164, 31299923, 32743991, 34011076, 34030699, 35154120, 37324276
Delayed Cranial Ossification due to CBFB Haploinsufficiency	Stimulate	33679772
Dermatitis Atopic	Associate	30543901
Dermatomyositis	Associate	25337792
Diabetes Mellitus	Associate	28903990, 29696068
Diabetes Mellitus Type 1	Associate	20176734, 20483768, 33966343, 35155683, 37324276
Drug Related Side Effects and Adverse Reactions	Associate	1332946, 1381359, 19380639, 29033545
Drug Related Side Effects and Adverse Reactions	Inhibit	20392859
Dykes Markes Harper syndrome	Associate	36064566
Empyema Pleural	Inhibit	23418597
Epilepsies Partial	Associate	31164164
Epstein Barr Virus Infections	Associate	19380639, 21406721
Epstein Barr Virus Infections	Inhibit	23418597
Erythrokeratodermia Variabilis	Associate	30543901
Esophageal Squamous Cell Carcinoma	Associate	27072986, 33374641
Exanthema	Associate	30543901
Familial cylindromatosis	Associate	37893484
Familial Mediterranean Fever	Associate	31376265
Fatigue Syndrome Chronic	Associate	30791746
Fever	Associate	31164164, 35154120, 37535999
Fibrocartilaginous embolism	Associate	33226960
Fibrosis	Associate	28448618, 31138864
Frontotemporal Dementia	Associate	35580510
Gastritis Atrophic	Associate	40138873
Genetic Diseases Inborn	Associate	32743991
Glioblastoma	Associate	19536297, 24901050
Gout	Associate	35524416, 35813414
Graft vs Host Disease	Associate	18814951
Graves Disease	Associate	24684463, 24798189
Hashimoto Disease	Associate	33966343, 34840214
Head and Neck Neoplasms	Associate	34344926
Heart Failure	Associate	37839544
Helicobacter Infections	Associate	35089437
Hematologic Diseases	Associate	22087647
Hematologic Neoplasms	Associate	26518771
Hemoglobinuria Paroxysmal	Associate	28630090
Hepatitis Autoimmune	Associate	28448618, 31138864
Hepatitis B	Associate	28784141
Hepatitis B Chronic	Associate	25890346, 28784141
Hepatitis C	Associate	26382585
Hepatitis C	Stimulate	31337730
Hepatitis Chronic	Associate	33966343
Hereditary Autoinflammatory Diseases	Associate	26642243, 31299923, 31376265, 32743991, 33042144, 33679772, 33966343, 34011076, 35154120, 37342083
Hereditary Breast and Ovarian Cancer Syndrome	Associate	35937947
Hereditary leiomyomatosis and renal cell cancer	Associate	19380639
Hodgkin Disease	Associate	19380639, 19648161, 23039325, 26650888, 31816062, 32079702
Hodgkin Disease	Inhibit	23418597
Hypertension	Associate	35446883
Hypertriglyceridemia	Associate	36064566
Hypoxia	Associate	19536297
IgA Vasculitis	Inhibit	35256897
Immune System Diseases	Associate	25890346, 26996111, 35486341
Immuno hemolytic anemia	Associate	25674272
Immunologic Deficiency Syndromes	Associate	32709905, 34808442
Infections	Associate	25404022, 33602138, 34176764
Inflammation	Associate	16124062, 17805211, 19536297, 20126412, 21127049, 21769840, 23054742, 23824412, 24500711, 24798189, 24852325, 25337792, 25890346, 26083362, 26642243 View all (20 more)
Inflammation	Inhibit	16164629, 19165919, 20483768, 22117534, 25050625, 25806576, 26890122, 27371733, 30543901, 31534975, 33226960, 35025147, 35154120, 36726689, 37893484
Inflammation	Stimulate	26426612
Inflammatory Bowel Diseases	Associate	17805211, 20483768, 31299923
Inflammatory Breast Neoplasms	Associate	18248671
Intervertebral Disc Degeneration	Stimulate	33226960
Intestinal Diseases	Associate	32719680
Kidney Diseases	Associate	31534975
Leukemia Large Granular Lymphocytic	Associate	33786584, 35015834
Leukemia Lymphocytic Chronic B Cell	Associate	33325634, 33679772
Leukemia T Cell	Associate	27637078
Leukoencephalopathies	Associate	33051914
Limbal Stem Cell Deficiency	Associate	29327472
Liver Failure	Associate	26681923, 28784141, 33966343
Lung Diseases Interstitial	Associate	25337792, 31299923
Lung Neoplasms	Associate	26367773
Lupus Erythematosus Systemic	Associate	19165918, 19165919, 19292917, 19439038, 20112363, 20169177, 20483768, 20617138, 20849588, 21336280, 21905002, 22087647, 24023622, 24039598, 26110642 View all (10 more)
Lupus Nephritis	Inhibit	26110642
Lymphatic Metastasis	Associate	26485275, 36033828
Lymphohistiocytosis Hemophagocytic	Associate	36064566
Lymphoma	Associate	22808296, 24159176, 25991819, 26679293, 31534975, 33025009, 33311649, 34840214
Lymphoma	Inhibit	23418597, 25856582
Lymphoma AIDS Related	Associate	21406721
Lymphoma B Cell	Associate	19380639, 21406721, 23039325, 26599546, 30301877, 30662920, 31816062, 40030008
Lymphoma B Cell Marginal Zone	Associate	19258598, 21115979, 24159176, 24349473, 25779943, 26679293, 27248180, 28152507, 28751561, 29674500, 29765142, 34021249, 34952945, 35528192, 36995085, 39313500 View all (1 more)
Lymphoma B Cell Marginal Zone	Inhibit	23418597
Lymphoma Follicular	Associate	24362818
Lymphoma Large B Cell Diffuse	Associate	19412164, 22550173, 23292937, 26518771, 26780579, 26819451, 28479318, 29463935, 30301877, 34558064, 37032379, 37505783, 37671152
Lymphoma Large B Cell Diffuse	Inhibit	19608751, 23418597, 25991819
Lymphoma Mantle Cell	Inhibit	19608751
Lymphoma Mantle Cell	Associate	32961552, 39313500
Lymphoma Non Hodgkin	Associate	19608751, 28751561, 30301877, 30662920
Lymphoma T Cell	Inhibit	23418597
Lymphoma T Cell	Associate	24611736, 27637078
Macrophage Activation Syndrome	Associate	31299923
malar rash	Associate	22087647
Malformations of Cortical Development	Associate	33051914
Marijuana Abuse	Stimulate	34500744
Measles	Associate	17538120
Meningioma	Associate	34772393
Meningococcal Infections	Associate	33468461
Metabolic Syndrome	Associate	29696068
Multiple Myeloma	Associate	20574050, 25856582, 26518771
Multiple Sclerosis	Associate	24852325, 26062845, 33051914
Multiple Trauma	Associate	23944604
Myasthenia Gravis	Associate	23049601, 28514294
Myelodysplastic Syndromes	Inhibit	38511647
Myocardial Infarction	Stimulate	35558073
Myocardial Infarction	Associate	37839544
Myositis	Associate	25337792
Myotonic Dystrophy	Associate	33530452
Negative rheumatoid factor polyarthritis	Associate	31534975
Neoplasm Metastasis	Associate	36033828
Neoplasms	Inhibit	19258598, 19380639, 19412164, 19608751, 21406721, 22843550, 25856582, 29718933
Neoplasms	Associate	24099634, 24357803, 26485275, 31242243, 32047491, 33298620, 33325634, 36033828, 38002938
Neoplasms Glandular and Epithelial	Associate	16164629
Nephritis	Associate	20617138
Nerve Degeneration	Inhibit	33226960
Niemann Pick Disease Type C	Associate	30867819
Obesity	Associate	37252693
Oral Ulcer	Associate	32719680
Osteoarthritis	Associate	23884832, 33782454, 37986345
Osteoporosis	Associate	34910834
Ovarian Neoplasms	Associate	37342083
Pain	Associate	34011076
Pancreatic Neoplasms	Associate	36596765
Pancreatitis	Associate	25050625
Parkinson Disease	Stimulate	36918862
Pericarditis	Associate	33966343
Periodontitis	Associate	34092220
Personality Disorders	Associate	25172408
Polycythemia Vera	Inhibit	35025147
Polymyositis	Associate	25337792
Polyps	Stimulate	24099634
Positive Pressure Respiration Intrinsic	Associate	34030699
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	24611736, 27637078
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	24611736, 36056685
Psoriasis	Associate	19169254, 20483768, 21326317, 22298274, 23054742, 26613086, 29696068, 30543901, 37893484
Purpura Thrombocytopenic Idiopathic	Associate	25806576, 29327472
Renal cell carcinoma 1	Associate	28448618
Retinal Dysplasia	Stimulate	27072986
Rhinitis Allergic	Associate	26996111
Sarcoma	Associate	29801054
Scleritis	Inhibit	33287909
Scleritis	Associate	33287909
Scleroderma Systemic	Associate	21769840, 23124809
Signs and Symptoms Digestive	Associate	37535999
Sjogren's Syndrome	Associate	21326317, 24097067, 24159176, 26679293, 26724675, 29655283, 30662920, 31534975, 35896530, 40298889
Small Cell Lung Carcinoma	Associate	32176034
Soft Tissue Injuries	Stimulate	35558073
Spondylitis Ankylosing	Associate	29940800, 31308453
Spondylitis Ankylosing	Inhibit	31206174
Squamous Cell Carcinoma of Head and Neck	Associate	34878732
Stomatitis Aphthous	Associate	33966343
Systemic Inflammatory Response Syndrome	Associate	25050625
Thyroiditis Autoimmune	Associate	24798189
Uniparental Disomy	Inhibit	19351844
Uterine Cervical Neoplasms	Associate	32975231
Uveomeningoencephalitic Syndrome	Associate	23555688
Vascular Diseases	Associate	21754991
Waldenstrom Macroglobulinemia	Associate	19351844, 30301877

TNFAIP3 (TNF alpha induced protein 3)