Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7128
Gene name Gene Name - the full gene name approved by the HGNC.
TNF alpha induced protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNFAIP3
Synonyms (NCBI Gene) Gene synonyms aliases
A20, AIFBL1, AISBL, OTUD7C, TNFA1P2
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well a
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs864321625 T>A Pathogenic Stop gained, coding sequence variant
rs864321626 C>T Pathogenic Stop gained, coding sequence variant
rs864321682 T>- Pathogenic Frameshift variant, coding sequence variant
rs864321683 G>- Pathogenic Frameshift variant, coding sequence variant
rs864321684 C>G Pathogenic Stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005955 hsa-miR-21-5p Luciferase reporter assay 21131358
MIRT005955 hsa-miR-21-5p Luciferase reporter assay 21131358
MIRT006380 hsa-miR-29a-3p Luciferase reporter assay 21763284
MIRT006380 hsa-miR-29a-3p Luciferase reporter assay 21763284
MIRT006471 hsa-miR-125a-5p qRT-PCR, Western blot 22550173
Transcription factors
Transcription factor Regulation Reference
NFKB1 Activation 11880364;19343319
NFKB1 Unknown 10807933
PML Repression 12080044
REL Activation 11880364
RELA Activation 11880364;19343319
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001922 Process B-1 B cell homeostasis IEA
GO:0001922 Process B-1 B cell homeostasis ISS
GO:0002020 Function Protease binding IPI 18223652
GO:0002237 Process Response to molecule of bacterial origin IDA 19912257
GO:0002237 Process Response to molecule of bacterial origin IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
191163 11896 ENSG00000118503
Protein
UniProt ID P21580
Protein name Tumor necrosis factor alpha-induced protein 3 (TNF alpha-induced protein 3) (EC 2.3.2.-) (EC 3.4.19.12) (OTU domain-containing protein 7C) (Putative DNA-binding protein A20) (Zinc finger protein A20) [Cleaved into: A20p50; A20p37]
Protein function Ubiquitin-editing enzyme that contains both ubiquitin ligase and deubiquitinase activities. Involved in immune and inflammatory responses signaled by cytokines, such as TNF-alpha and IL-1 beta, or pathogens via Toll-like receptors (TLRs) through
PDB 2EQE , 2EQF , 2EQG , 2VFJ , 3DKB , 3OJ3 , 3OJ4 , 3VUW , 3VUX , 3VUY , 3ZJD , 3ZJE , 3ZJF , 3ZJG , 5LRX , 5V3B , 5V3P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02338 OTU 98 257 OTU-like cysteine protease Family
PF01754 zf-A20 385 409 A20-like zinc finger Family
PF01754 zf-A20 476 500 A20-like zinc finger Family
PF01754 zf-A20 655 678 A20-like zinc finger Family
PF01754 zf-A20 760 784 A20-like zinc finger Family
Sequence
MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQF
REIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDL
VLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTP
MARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPA
QECYRYPIVLGYDSHHF
VPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKE
KLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENS
EQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPK
LNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRS
PGCPFTLNVQHNGFCERCHN
ARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCF
KRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGD
RTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGR
ECGTLGSTMFEGYCQKCF
IEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARAS
CKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCN
ECFQ
FKQMYG
Sequence length 790
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  NF-kappa B signaling pathway
Necroptosis
NOD-like receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Measles
Epstein-Barr virus infection
  NOD1/2 Signaling Pathway
TNFR1-induced proapoptotic signaling
Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
Ovarian tumor domain proteases
Negative regulators of DDX58/IFIH1 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Autoinflammatory Disease Autoinflammatory syndrome, familial, Behcet-like 1 rs864321685, rs1776278098, rs864321625, rs864321682, rs864321626, rs864321684 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Eczema Eczema N/A N/A GWAS
Hereditary Pediatric Behcet-Like Disease N/A N/A GenCC
Psoriasis Psoriasis N/A N/A GWAS
Psoriasis vulgaris Psoriasis vulgaris N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acne Vulgaris Stimulate 33241420
Acute Lung Injury Associate 38071255
Acute On Chronic Liver Failure Stimulate 26426612
Adenocarcinoma of Lung Associate 40682067
Adenoma Stimulate 24099634
Adenomatous Polyposis Coli Associate 24099634
Agammaglobulinemia Associate 33679772
Anemia Associate 37535999
Anemia Pernicious Associate 33966343
Arthralgia Associate 33966343