Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7126
Gene name Gene Name - the full gene name approved by the HGNC.
TNF alpha induced protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNFAIP1
Synonyms (NCBI Gene) Gene synonyms aliases
B12, B61, BTBD34, EDP1, hBACURD2
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. Studies of a similar gene in mouse suggest that the expression of this gene is developmentally regulated in a
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002521 hsa-miR-373-3p Microarray 15685193
MIRT002521 hsa-miR-373-3p Microarray;Other 15685193
MIRT051605 hsa-let-7e-5p CLASH 23622248
MIRT051004 hsa-miR-17-5p CLASH 23622248
MIRT042325 hsa-miR-484 CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity IBA
GO:0004842 Function Ubiquitin-protein transferase activity IDA 19782033
GO:0005515 Function Protein binding IPI 19615732, 19637314, 21145461, 21988832, 25416956, 28514442, 32296183, 32814053, 33961781, 34591642
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IDA 19637314
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
191161 11894 ENSG00000109079
Protein
UniProt ID Q13829
Protein name BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2 (hBACURD2) (BTB/POZ domain-containing protein TNFAIP1) (Protein B12) (Tumor necrosis factor, alpha-induced protein 1, endothelial)
Protein function Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex involved in regulation of cytoskeleton structure. The BCR(TNFAIP1) E3 ubiquitin ligase complex mediates the ubiquitination of RHOA, leading to its degradatio
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02214 BTB_2 30 120 BTB/POZ domain Domain
Sequence
MSGDTCLCPASGAKPKLSGFKGGGLGNKYVQLNVGGSLYYTTVRALTRHDTMLKAMFSGR
MEVLTDKEGWILIDRCGKHFGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQGLVNMC

QSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYSYTSNSDDHLL
KNIELFDKLSLRFNGRVLFIKDVIGDEICCWSFYGQGRKLAEVCCTSIVYATEKKQTKVE
FPEARIYEETLNVLLYETPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRY
STYDDRQLGHQSTHRD
Sequence length 316
Interactions View interactions
<