TM4SF4 (transmembrane 4 L six family member 4)

Gene

• Entrez ID: 7104
• Gene name: Transmembrane 4 L six family member 4
• Gene symbol: TM4SF4
• Synonyms (NCBI Gene): ILTMP, il-TMP
• Chromosome: 3
• Chromosome location: 3q25.1
• Summary: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2461538	hsa-miR-1298	CLIP-seq
MIRT2461539	hsa-miR-219-1-3p	CLIP-seq
MIRT2461540	hsa-miR-4272	CLIP-seq
MIRT2461541	hsa-miR-571	CLIP-seq
MIRT2461542	hsa-miR-664	CLIP-seq
MIRT2461543	hsa-miR-95	CLIP-seq
MIRT2461538	hsa-miR-1298	CLIP-seq
MIRT2461539	hsa-miR-219-1-3p	CLIP-seq
MIRT2461540	hsa-miR-4272	CLIP-seq
MIRT2461541	hsa-miR-571	CLIP-seq
MIRT2461542	hsa-miR-664	CLIP-seq
MIRT2461543	hsa-miR-95	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0042246	Process	Tissue regeneration	IEA

Other IDs

• MIM: 606567
• HGNC: 11856
• e!Ensembl: ENSG00000169903

Protein

• UniProt ID: P48230
• Protein name: Transmembrane 4 L6 family member 4 (Intestine and liver tetraspan membrane protein) (IL-TMP)
• Protein function: Regulates the adhesive and proliferative status of intestinal epithelial cells. Can mediate density-dependent cell proliferation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05805	L6_membrane	1 → 191	L6 membrane protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Jejunum and liver.
• Sequence:

  MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMI
  FPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKC
  LMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVN
  GLLGTLCGDCQCCGCCGGDGPV

• Sequence length: 202

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHOLELITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Breast Neoplasms	Associate	32972043	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Stimulate	22236579	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	22236579, 39999090	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	22011044, 28687755, 37535601	★☆☆☆☆ Found in Text Mining only
Liver Failure	Stimulate	22236579	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Stimulate	32972043	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	22011044	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	22011044	★☆☆☆☆ Found in Text Mining only