Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7099
Gene name	Toll like receptor 4
Gene symbol	TLR4
Synonyms (NCBI Gene)	ARMD10CD284TLR-4TOLL
Chromosome	9
Chromosome location	9q33.1
Summary	The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func

210

Show/Hide all (210)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003050	hsa-let-7i-5p	Luciferase reporter assayqRT-PCRWestern blot	17660297
MIRT003050	hsa-let-7i-5p	Luciferase reporter assayqRT-PCRWestern blot	17660297
MIRT006530	hsa-miR-146a-5p	ELISALuciferase reporter assayMicroarrayqRT-PCRWestern blot	21329689
MIRT006530	hsa-miR-146a-5p	ELISALuciferase reporter assayMicroarrayqRT-PCRWestern blot	21329689
MIRT006530	hsa-miR-146a-5p	ELISALuciferase reporter assayMicroarrayqRT-PCRWestern blot	21329689
MIRT006530	hsa-miR-146a-5p	ELISALuciferase reporter assayMicroarrayqRT-PCRWestern blot	21329689
MIRT018411	hsa-miR-335-5p	Microarray	18185580
MIRT023907	hsa-miR-1-3p	Microarray	18668037
MIRT031004	hsa-miR-21-5p	Microarray	18591254
MIRT053375	hsa-miR-146b-5p	Luciferase reporter assayqRT-PCR	23798430
MIRT438116	hsa-let-7b-5p	Luciferase reporter assay	23437218
MIRT438116	hsa-let-7b-5p	Luciferase reporter assay	23437218
MIRT438116	hsa-let-7b-5p	Luciferase reporter assay	23437218
MIRT438116	hsa-let-7b-5p	Luciferase reporter assay	23437218
MIRT722926	hsa-miR-548g-3p	HITS-CLIP	19536157
MIRT722925	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT722924	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT722923	hsa-miR-4738-3p	HITS-CLIP	19536157
MIRT722922	hsa-miR-630	HITS-CLIP	19536157
MIRT722921	hsa-miR-4279	HITS-CLIP	19536157
MIRT722920	hsa-miR-3658	HITS-CLIP	19536157
MIRT722919	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT722918	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT449831	hsa-miR-4694-3p	PAR-CLIP	22100165
MIRT449830	hsa-miR-4698	PAR-CLIP	22100165
MIRT449829	hsa-miR-1468-3p	PAR-CLIP	22100165
MIRT449828	hsa-miR-7-5p	PAR-CLIP	22100165
MIRT449827	hsa-miR-6077	PAR-CLIP	22100165
MIRT449826	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT732201	hsa-miR-26b-5p	qPCRLuciferase reporter assay	26222045
MIRT732201	hsa-miR-26b-5p	qRT-PCRLuciferase reporter assay	26222045
MIRT732436	hsa-miR-485-3p	ELISALuciferase reporter assayqRT-PCRWestern blotting	34103911
MIRT449829	hsa-miR-1468-3p	ImmunofluorescenceqRT-PCR	34073556
MIRT732637	hsa-miR-5787	ELISAImmunofluorescenceLuciferase reporter assayWestern blotting	33165670
MIRT732899	hsa-miR-140-5p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCRFlow cytometry	33122931
MIRT733048	hsa-miR-202-3p	ELISAqRT-PCR	33893248
MIRT733483	hsa-miR-4268	ImmunofluorescenceRNA-seqqRT-PCRWestern blotting	34120606
MIRT733771	hsa-miR-23b-5p	Luciferase reporter assayqRT-PCRWestern blotting	34110366
MIRT734334	hsa-miR-146a-3p	qRT-PCRWestern blotting	32176822
MIRT732899	hsa-miR-140-5p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCRFlow cytometryELISA	32073611
MIRT735023	hsa-miR-301a-3p	ELISA	33121303
MIRT006530	hsa-miR-146a-5p	qRT-PCR	31739406
MIRT735567	hsa-miR-329-3p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	33262815
MIRT735572	hsa-miR-885-3p	ELISALuciferase reporter assayqRT-PCRWestern blotting	31763742
MIRT735623	hsa-miR-216a-5p	Luciferase reporter assayWestern blottingMicroarrayImmunofluorescenceqRT-PCRELISA	32019561
MIRT732899	hsa-miR-140-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)ImmunofluorescenceIn situ hybridizationFlow cytometry	31769066
MIRT736832	hsa-miR-103a-3p	qRT-PCR	32941517
MIRT736833	hsa-miR-107	qRT-PCR	32941517
MIRT737245	hsa-miR-145-3p	Luciferase reporter assayWestern blottingqRT-PCR	32801865
MIRT737392	hsa-miR-1178-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)RNA-seqqRT-PCR	32059341
MIRT722926	hsa-miR-548g-3p	HITS-CLIP	19536157
MIRT722925	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT722924	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT722923	hsa-miR-4738-3p	HITS-CLIP	19536157
MIRT722922	hsa-miR-630	HITS-CLIP	19536157
MIRT722921	hsa-miR-4279	HITS-CLIP	19536157
MIRT722920	hsa-miR-3658	HITS-CLIP	19536157
MIRT722919	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT722918	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT449831	hsa-miR-4694-3p	PAR-CLIP	22100165
MIRT449830	hsa-miR-4698	PAR-CLIP	22100165
MIRT449829	hsa-miR-1468-3p	PAR-CLIP	22100165
MIRT449828	hsa-miR-7-5p	PAR-CLIP	22100165
MIRT449827	hsa-miR-6077	PAR-CLIP	22100165
MIRT449826	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT735572	hsa-miR-885-3p	Luciferase reporter assayWestern blottingqRT-PCR	35156897
MIRT755856	hsa-miR-711	Luciferase reporter assayWestern blottingqRT-PCR	36114541
MIRT755896	hsa-miR-16-5p	Luciferase reporter assayWestern blottingqRT-PCRImmunofluorescenceELISA	34854364
MIRT755916	hsa-miR-145-5p	Luciferase reporter assayWestern blottingqRT-PCR	35722425
MIRT722922	hsa-miR-630	Luciferase reporter assayqRT-PCR	36926413
MIRT756208	hsa-miR-4512	Luciferase reporter assayWestern blottingqRT-PCR	34721432
MIRT2127863	hsa-miR-1273g	CLIP-seq
MIRT2127864	hsa-miR-181a	CLIP-seq
MIRT2127865	hsa-miR-181b	CLIP-seq
MIRT2127866	hsa-miR-181c	CLIP-seq
MIRT2127867	hsa-miR-181d	CLIP-seq
MIRT2127868	hsa-miR-197	CLIP-seq
MIRT2127869	hsa-miR-203	CLIP-seq
MIRT2127870	hsa-miR-2053	CLIP-seq
MIRT2127871	hsa-miR-216a	CLIP-seq
MIRT2127872	hsa-miR-216b	CLIP-seq
MIRT2127873	hsa-miR-23a	CLIP-seq
MIRT2127874	hsa-miR-23b	CLIP-seq
MIRT2127875	hsa-miR-23c	CLIP-seq
MIRT2127876	hsa-miR-3160-5p	CLIP-seq
MIRT2127877	hsa-miR-3689a-5p	CLIP-seq
MIRT2127878	hsa-miR-3689b	CLIP-seq
MIRT2127879	hsa-miR-3689e	CLIP-seq
MIRT2127880	hsa-miR-3689f	CLIP-seq
MIRT2127881	hsa-miR-3929	CLIP-seq
MIRT2127882	hsa-miR-4262	CLIP-seq
MIRT2127883	hsa-miR-4289	CLIP-seq
MIRT2127884	hsa-miR-4311	CLIP-seq
MIRT2127885	hsa-miR-4318	CLIP-seq
MIRT2127886	hsa-miR-433	CLIP-seq
MIRT2127887	hsa-miR-4419b	CLIP-seq
MIRT2127888	hsa-miR-4427	CLIP-seq
MIRT2127889	hsa-miR-4478	CLIP-seq
MIRT2127890	hsa-miR-4645-3p	CLIP-seq
MIRT2127891	hsa-miR-4693-5p	CLIP-seq
MIRT2127892	hsa-miR-4761-5p	CLIP-seq
MIRT2127893	hsa-miR-548ag	CLIP-seq
MIRT2127894	hsa-miR-548ai	CLIP-seq
MIRT2127895	hsa-miR-550b	CLIP-seq
MIRT2127896	hsa-miR-569	CLIP-seq
MIRT2127897	hsa-miR-889	CLIP-seq
MIRT2127898	hsa-miR-892a	CLIP-seq
MIRT2127899	hsa-miR-944	CLIP-seq
MIRT2127863	hsa-miR-1273g	CLIP-seq
MIRT2127877	hsa-miR-3689a-5p	CLIP-seq
MIRT2127878	hsa-miR-3689b	CLIP-seq
MIRT2127879	hsa-miR-3689e	CLIP-seq
MIRT2127880	hsa-miR-3689f	CLIP-seq
MIRT2349552	hsa-miR-3940-5p	CLIP-seq
MIRT2127883	hsa-miR-4289	CLIP-seq
MIRT2349553	hsa-miR-4507	CLIP-seq
MIRT2349554	hsa-miR-587	CLIP-seq
MIRT2395856	hsa-miR-619	CLIP-seq
MIRT2643048	hsa-miR-122	CLIP-seq
MIRT2127863	hsa-miR-1273g	CLIP-seq
MIRT2643049	hsa-miR-1279	CLIP-seq
MIRT2643050	hsa-miR-145	CLIP-seq
MIRT2643051	hsa-miR-18a	CLIP-seq
MIRT2643052	hsa-miR-18b	CLIP-seq
MIRT2127869	hsa-miR-203	CLIP-seq
MIRT2643053	hsa-miR-2052	CLIP-seq
MIRT2643054	hsa-miR-219-5p	CLIP-seq
MIRT2643055	hsa-miR-2355-3p	CLIP-seq
MIRT2643056	hsa-miR-3064-3p	CLIP-seq
MIRT2643057	hsa-miR-3117-5p	CLIP-seq
MIRT2643058	hsa-miR-3180-5p	CLIP-seq
MIRT2643059	hsa-miR-345	CLIP-seq
MIRT2127877	hsa-miR-3689a-5p	CLIP-seq
MIRT2127878	hsa-miR-3689b	CLIP-seq
MIRT2127879	hsa-miR-3689e	CLIP-seq
MIRT2127880	hsa-miR-3689f	CLIP-seq
MIRT2643060	hsa-miR-3913-3p	CLIP-seq
MIRT2643061	hsa-miR-3920	CLIP-seq
MIRT2643062	hsa-miR-4256	CLIP-seq
MIRT2127883	hsa-miR-4289	CLIP-seq
MIRT2643063	hsa-miR-4303	CLIP-seq
MIRT2127885	hsa-miR-4318	CLIP-seq
MIRT2643064	hsa-miR-4328	CLIP-seq
MIRT2643065	hsa-miR-4445	CLIP-seq
MIRT2643066	hsa-miR-4635	CLIP-seq
MIRT2643067	hsa-miR-4652-3p	CLIP-seq
MIRT2643068	hsa-miR-4680-3p	CLIP-seq
MIRT2643069	hsa-miR-4735-3p	CLIP-seq
MIRT2643070	hsa-miR-4762-3p	CLIP-seq
MIRT2643071	hsa-miR-4782-3p	CLIP-seq
MIRT2643072	hsa-miR-4793-5p	CLIP-seq
MIRT2643073	hsa-miR-489	CLIP-seq
MIRT2643074	hsa-miR-508-3p	CLIP-seq
MIRT2643075	hsa-miR-511	CLIP-seq
MIRT2643076	hsa-miR-514	CLIP-seq
MIRT2643077	hsa-miR-514b-3p	CLIP-seq
MIRT2643078	hsa-miR-526b	CLIP-seq
MIRT2643079	hsa-miR-549	CLIP-seq
MIRT2643080	hsa-miR-578	CLIP-seq
MIRT2643081	hsa-miR-579	CLIP-seq
MIRT2395856	hsa-miR-619	CLIP-seq
MIRT2643082	hsa-miR-676	CLIP-seq
MIRT2643083	hsa-miR-943	CLIP-seq
MIRT2643048	hsa-miR-122	CLIP-seq
MIRT2127863	hsa-miR-1273g	CLIP-seq
MIRT2643049	hsa-miR-1279	CLIP-seq
MIRT2693220	hsa-miR-1298	CLIP-seq
MIRT2643050	hsa-miR-145	CLIP-seq
MIRT2643051	hsa-miR-18a	CLIP-seq
MIRT2643052	hsa-miR-18b	CLIP-seq
MIRT2127869	hsa-miR-203	CLIP-seq
MIRT2643053	hsa-miR-2052	CLIP-seq
MIRT2643054	hsa-miR-219-5p	CLIP-seq
MIRT2643055	hsa-miR-2355-3p	CLIP-seq
MIRT2643056	hsa-miR-3064-3p	CLIP-seq
MIRT2643057	hsa-miR-3117-5p	CLIP-seq
MIRT2643058	hsa-miR-3180-5p	CLIP-seq
MIRT2643059	hsa-miR-345	CLIP-seq
MIRT2127877	hsa-miR-3689a-5p	CLIP-seq
MIRT2127878	hsa-miR-3689b	CLIP-seq
MIRT2127879	hsa-miR-3689e	CLIP-seq
MIRT2127880	hsa-miR-3689f	CLIP-seq
MIRT2643060	hsa-miR-3913-3p	CLIP-seq
MIRT2643061	hsa-miR-3920	CLIP-seq
MIRT2643062	hsa-miR-4256	CLIP-seq
MIRT2693221	hsa-miR-4275	CLIP-seq
MIRT2127883	hsa-miR-4289	CLIP-seq
MIRT2127885	hsa-miR-4318	CLIP-seq
MIRT2643064	hsa-miR-4328	CLIP-seq
MIRT2643065	hsa-miR-4445	CLIP-seq
MIRT2643066	hsa-miR-4635	CLIP-seq
MIRT2643068	hsa-miR-4680-3p	CLIP-seq
MIRT2643069	hsa-miR-4735-3p	CLIP-seq
MIRT2643070	hsa-miR-4762-3p	CLIP-seq
MIRT2693222	hsa-miR-4774-5p	CLIP-seq
MIRT2643071	hsa-miR-4782-3p	CLIP-seq
MIRT2643072	hsa-miR-4793-5p	CLIP-seq
MIRT2643073	hsa-miR-489	CLIP-seq
MIRT2643074	hsa-miR-508-3p	CLIP-seq
MIRT2643075	hsa-miR-511	CLIP-seq
MIRT2643076	hsa-miR-514	CLIP-seq
MIRT2643077	hsa-miR-514b-3p	CLIP-seq
MIRT2643078	hsa-miR-526b	CLIP-seq
MIRT2643079	hsa-miR-549	CLIP-seq
MIRT2643080	hsa-miR-578	CLIP-seq
MIRT2643081	hsa-miR-579	CLIP-seq
MIRT2395856	hsa-miR-619	CLIP-seq
MIRT2643082	hsa-miR-676	CLIP-seq
MIRT2643083	hsa-miR-943	CLIP-seq
MIRT2127899	hsa-miR-944	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
IRF3	Unknown	22208359
IRF8	Unknown	10734131
SPI1	Activation	16785240;20956019
SPI1	Unknown	10734131
STAT6	Repression	16433852
ZNF160	Repression	19846881

211

Show/Hide all (211)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IBA
GO:0001530	Function	Lipopolysaccharide binding	IMP	16514062
GO:0001530	Function	Lipopolysaccharide binding	NAS	10835634
GO:0001540	Function	Amyloid-beta binding	IC	20037584
GO:0001726	Component	Ruffle	IEA
GO:0001875	Function	Lipopolysaccharide immune receptor activity	IBA
GO:0001875	Function	Lipopolysaccharide immune receptor activity	IDA	19252480
GO:0001891	Component	Phagocytic cup	IDA	30883606
GO:0002218	Process	Activation of innate immune response	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	IDA	14607928
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0002246	Process	Wound healing involved in inflammatory response	IEA
GO:0002322	Process	B cell proliferation involved in immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002537	Process	Nitric oxide production involved in inflammatory response	IEA
GO:0002730	Process	Regulation of dendritic cell cytokine production	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IBA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IDA	20037584, 38670073
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	ISS
GO:0004888	Function	Transmembrane signaling receptor activity	IDA	15618008
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	NAS	11970998
GO:0005102	Function	Signaling receptor binding	IPI	20037584
GO:0005515	Function	Protein binding	IPI	11441107, 11544529, 12925853, 15356101, 15728506, 16622205, 17064675, 17126326, 17258210, 17803912, 19060881, 19252480, 19509286, 20037584, 20547845, 21383675, 21829704, 21903422, 22474354, 22532668, 25187624, 29150600, 29190778, 36232715
GO:0005737	Component	Cytoplasm	IDA	19740627
GO:0005737	Component	Cytoplasm	IPI	20037584
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12055629, 38670073
GO:0005886	Component	Plasma membrane	IDA	11274165, 15027902, 16338228, 19740627, 36232715
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	NAS	33576548
GO:0005886	Component	Plasma membrane	TAS
GO:0006809	Process	Nitric oxide biosynthetic process	IEA
GO:0006909	Process	Phagocytosis	IDA	30883606
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	10426995
GO:0007165	Process	Signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	1406630, 9346484, 25038658, 34721373
GO:0007254	Process	JNK cascade	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009897	Component	External side of plasma membrane	IDA	16514062
GO:0009986	Component	Cell surface	IDA	25204797
GO:0010008	Component	Endosome membrane	IDA	18222170
GO:0010008	Component	Endosome membrane	TAS
GO:0010467	Process	Gene expression	IEA
GO:0010572	Process	Positive regulation of platelet activation	IEA
GO:0010572	Process	Positive regulation of platelet activation	ISS	16514062
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	23817958
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0014002	Process	Astrocyte development	IEA
GO:0014004	Process	Microglia differentiation	IEA
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IEA
GO:0016020	Component	Membrane	IEA
GO:0016046	Process	Detection of fungus	NAS	11254600
GO:0022008	Process	Neurogenesis	IEA
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IDA	1406630, 9346484, 25038658, 34721373
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	10880523
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IGI	10880523
GO:0032496	Process	Response to lipopolysaccharide	IC	16514062
GO:0032496	Process	Response to lipopolysaccharide	IDA	12594207
GO:0032496	Process	Response to lipopolysaccharide	IDA	14607928
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032497	Process	Detection of lipopolysaccharide	IBA
GO:0032497	Process	Detection of lipopolysaccharide	IDA	19252480
GO:0032497	Process	Detection of lipopolysaccharide	IEA
GO:0032680	Process	Regulation of tumor necrosis factor production	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032689	Process	Negative regulation of type II interferon production	ISS
GO:0032700	Process	Negative regulation of interleukin-17 production	IEA
GO:0032700	Process	Negative regulation of interleukin-17 production	ISS
GO:0032707	Process	Negative regulation of interleukin-23 production	IEA
GO:0032707	Process	Negative regulation of interleukin-23 production	ISS
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	ISS
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	ISS
GO:0032722	Process	Positive regulation of chemokine production	IDA	19740627
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032727	Process	Positive regulation of interferon-alpha production	IEA
GO:0032727	Process	Positive regulation of interferon-alpha production	ISS
GO:0032728	Process	Positive regulation of interferon-beta production	IEA
GO:0032728	Process	Positive regulation of interferon-beta production	ISS
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	ISS
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	11432859
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032732	Process	Positive regulation of interleukin-1 production	IEA
GO:0032732	Process	Positive regulation of interleukin-1 production	ISS
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	15027902
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	19740627
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	21329689, 30321456
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	17951129, 19740627, 21329689
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	17951129
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	30321456
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IEA
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IBA
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	16751103
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	10196138, 15618008, 18222170
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IEA
GO:0034143	Process	Regulation of toll-like receptor 4 signaling pathway	IDA	19289601
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	IEA
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	ISS
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IEA
GO:0038023	Function	Signaling receptor activity	IDA	15618008, 16751103, 18222170
GO:0038023	Function	Signaling receptor activity	TAS	10426995
GO:0042088	Process	T-helper 1 type immune response	NAS	11970998
GO:0042100	Process	B cell proliferation	IEA
GO:0042116	Process	Macrophage activation	IMP	10835634
GO:0042742	Process	Defense response to bacterium	IGI	30321456
GO:0042742	Process	Defense response to bacterium	TAS	10426995
GO:0042802	Function	Identical protein binding	IPI	23059983, 23155421, 31319868
GO:0042995	Component	Cell projection	IEA
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0043032	Process	Positive regulation of macrophage activation	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	16968406, 19740627
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IGI	20037584
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	30233718
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043235	Component	Receptor complex	IEA
GO:0043235	Component	Receptor complex	IPI	19252480, 20037584
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	NAS	33576548
GO:0045087	Process	Innate immune response	TAS	15356140
GO:0045321	Process	Leukocyte activation	IEA
GO:0045342	Process	MHC class II biosynthetic process	IEA
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0045671	Process	Negative regulation of osteoclast differentiation	NAS	12133979
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046651	Process	Lymphocyte proliferation	IEA
GO:0046696	Component	Lipopolysaccharide receptor complex	IBA
GO:0046696	Component	Lipopolysaccharide receptor complex	IDA	11274165, 19252480
GO:0046982	Function	Protein heterodimerization activity	IPI	20037584
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15027902
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	19740627
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IMP	21329689
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA
GO:0050829	Process	Defense response to Gram-negative bacterium	IC	16514062
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	12594207
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	29038465
GO:0051132	Process	NK T cell activation	IDA	17057721
GO:0051403	Process	Stress-activated MAPK cascade	IEA
GO:0051606	Process	Detection of stimulus	IEA
GO:0060729	Process	Intestinal epithelial structure maintenance	IEA
GO:0060729	Process	Intestinal epithelial structure maintenance	ISS
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IDA	16314496
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070427	Process	Nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA
GO:0070430	Process	Positive regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA
GO:0070431	Process	Nucleotide-binding oligomerization domain containing 2 signaling pathway	IEA
GO:0070434	Process	Positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	11432859
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IGI	30321456
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071223	Process	Cellular response to lipoteichoic acid	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071346	Process	Cellular response to type II interferon	IDA	11672593
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	26370079
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IDA	20037584
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IEA
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	ISS
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IDA	16968406
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	16968406
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IMP	30321456
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	ISS
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IEA
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	ISS
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	IEA
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	ISS
GO:1903974	Process	Positive regulation of cellular response to macrophage colony-stimulating factor stimulus	IDA	11672593
GO:1904466	Process	Positive regulation of matrix metallopeptidase secretion	IMP	21329689
GO:1904646	Process	Cellular response to amyloid-beta	IDA	20037584
GO:1904646	Process	Cellular response to amyloid-beta	IGI	20037584
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IMP	21329689
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	ISS

MIM	HGNC	e!Ensembl
603030	11850	ENSG00000136869

O00206

Protein name

Toll-like receptor 4 (hToll) (CD antigen CD284)

Protein function

Transmembrane receptor that functions as a pattern recognition receptor recognizing pathogen- and damage-associated molecular patterns (PAMPs and DAMPs) to induce innate immune responses via downstream signaling pathways (PubMed:10835634, PubMed

PDB

2Z62 , 2Z63 , 2Z65 , 2Z66 , 3FXI , 3UL7 , 3UL8 , 3UL9 , 3ULA , 4G8A , 5NAM , 5NAO , 8WO1 , 8WTA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13855	LRR_8	55 → 114	Leucine rich repeat	Repeat
PF13855	LRR_8	78 → 138	Leucine rich repeat	Repeat
PF13855	LRR_8	126 → 187	Leucine rich repeat	Repeat
PF13855	LRR_8	150 → 207	Leucine rich repeat	Repeat
PF13855	LRR_8	447 → 508	Leucine rich repeat	Repeat
PF13855	LRR_8	485 → 532	Leucine rich repeat	Repeat
PF13855	LRR_8	496 → 556	Leucine rich repeat	Repeat
PF01582	TIR	674 → 839	TIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in placenta, spleen and peripheral blood leukocytes (PubMed:9237759, PubMed:9435236). Detected in monocytes, macrophages, dendritic cells and several types of T-cells (PubMed:27022195, PubMed:9237759). Expressed in pan

Sequence

MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLD
LSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALG
AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHL
DLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSL
NVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDI
IDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTS
NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLG
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAG
NSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPY
KCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLML
LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA
NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR
QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI

Sequence length

839

Interactions

View interactions

	KEGG		Reactome
	NF-kappa B signaling pathway HIF-1 signaling pathway Phagosome PI3K-Akt signaling pathway Necroptosis Neutrophil extracellular trap formation Toll-like receptor signaling pathway NOD-like receptor signaling pathway Alcoholic liver disease Pathogenic Escherichia coli infection Shigellosis Salmonella infection Pertussis Legionellosis Yersinia infection Leishmaniasis Chagas disease Malaria Toxoplasmosis Amoebiasis Tuberculosis Hepatitis B Measles Influenza A Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Proteoglycans in cancer PD-L1 expression and PD-1 checkpoint pathway in cancer Inflammatory bowel disease Rheumatoid arthritis Lipid and atherosclerosis		ER-Phagosome pathway Caspase activation via Death Receptors in the presence of ligand Toll Like Receptor 4 (TLR4) Cascade MyD88:MAL(TIRAP) cascade initiated on plasma membrane MyD88-independent TLR4 cascade TRIF-mediated programmed cell death MyD88 deficiency (TLR2/4) IRAK4 deficiency (TLR2/4) Regulation of TLR by endogenous ligand Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon IKK complex recruitment mediated by RIP1 TRAF6-mediated induction of TAK1 complex within TLR4 complex IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
COPD, severe early onset	Benign	rs4986790, rs4986791	RCV003390649 RCV003390650
Hepatocellular carcinoma	Benign	rs5030719	RCV005938760
Hereditary angioedema with normal C1Inh	not provided	rs1588095779	RCV001027422
Lung adenocarcinoma	Likely benign; Uncertain significance	rs200675400, rs1005484206, rs2490699868, rs2490712862	RCV003129602 RCV003129691 RCV003129696 RCV003129717
Pericementitis	Benign	rs4986790	RCV001729340
Squamous cell carcinoma	Likely benign	rs2490715531	RCV003129683
Susceptibility to severe coronavirus disease (COVID-19)	Benign	rs4986790	RCV003231092
Susceptibility to severe COVID-19	Conflicting classifications of pathogenicity	rs749154041	RCV003120839
TLR4 POLYMORPHISM	Benign	rs4986790, rs4986791	RCV000007040 RCV000007043
TLR4-related disorder	Likely benign; Benign	rs16906079, rs56302444, rs140661916, rs5030719, rs147453131, rs5030711	RCV003911545 RCV003952013 RCV003931496 RCV003914585 RCV003976703 RCV003918423

Show/Hide Text Mining Associations (674)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abdominal Injuries	Stimulate	37876569
Abnormalities Drug Induced	Associate	25120286
Absent corpus callosum cataract immunodeficiency	Associate	34689707
Acanthamoeba Keratitis	Associate	33755043
Acne Vulgaris	Associate	29927962, 31662521
Acquired Immunodeficiency Syndrome	Associate	33777838
Acute Aortic Syndrome	Stimulate	30497388
Acute Aortic Syndrome	Associate	33426065
Acute Coronary Syndrome	Stimulate	18373609, 19556696, 25179298
Acute Coronary Syndrome	Associate	20447947, 28407320
Acute Disease	Associate	11529488
Acute Kidney Injury	Associate	19218437, 28898406, 35510365
Acute Lung Injury	Associate	21126389
Acute On Chronic Liver Failure	Stimulate	17177978
Acute On Chronic Liver Failure	Associate	33717119, 37816833
Adenocarcinoma	Associate	21455638, 23525077, 27008696, 28531216
Adenocarcinoma of Lung	Associate	29788922, 29927028, 32445554, 35135563, 37746997
Adenoma	Stimulate	24887394, 33255933
Adenoma	Associate	29802748, 30598580
Adenomatous Polyps	Associate	37404119
Adenomyosis	Associate	26898650, 32921982, 37967572
Adrenal Insufficiency	Associate	21466684
Airway Obstruction	Associate	34332337
Alcoholism	Associate	26208141
Alcoholism	Stimulate	35371104
Allergic Fungal Sinusitis	Associate	25973005
Alzheimer Disease	Associate	23272070, 29671417, 30584014, 39183433, 39266981
Amyotrophic lateral sclerosis 1	Stimulate	20884065
Anaphylaxis	Stimulate	30189430
Anemia Aplastic	Associate	40481763
Aneurysm Ascending Aorta	Inhibit	31363123
Angina Stable	Stimulate	15725697
Angina Stable	Associate	18373609, 19556696, 23023379, 28407320
Angina Unstable	Stimulate	15725697
Angioedemas Hereditary	Associate	31236065
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	24773611, 29923769, 33974049
Antiphospholipid Syndrome	Associate	22106343, 22932793
Aortic Aneurysm	Associate	30530865, 30922233
Aortic Aneurysm Abdominal	Associate	29549671, 30922233, 34348653
Aortic Aneurysm Thoracic	Associate	25120286, 30530865
Aortic Valve Disease	Associate	26515875
Aortic Valve Stenosis	Associate	19195606, 25275309, 32074942, 33189669
Appendicitis	Associate	24336024
Arterial Occlusive Diseases	Stimulate	32022379
Arthritis Gouty	Associate	23738004
Arthritis Infectious	Associate	25412934
Arthritis Juvenile	Associate	15498795, 19248102, 23121667, 28222760, 28935693, 31941549
Arthritis Psoriatic	Associate	26830904, 34580414
Arthritis Rheumatoid	Associate	12847679, 15593217, 16052591, 16606645, 17255320, 18584044, 18765427, 19035519, 20615213, 21647866, 21654189, 22661088, 24286242, 24302816, 24643522 View all (15 more)
Arthritis Rheumatoid	Stimulate	15986373, 17599732, 33377396
Arthritis Rheumatoid	Inhibit	35126351
Ascites	Associate	17094388, 30610800
Asthma	Associate	19159017, 21570715, 21905500, 22151743, 22994343, 23861935, 24524443, 24851022, 25036518, 26191227, 26831416, 27084682, 27977294, 29486764, 29504915 View all (6 more)
Asthma	Inhibit	19842845
Astrocytoma	Associate	23684765, 29912993
Ataxia	Associate	32967147
Ataxia Telangiectasia	Associate	20488792
Atelosteogenesis type 2	Associate	34425224
Atherosclerosis	Associate	12124407, 12796470, 15882292, 15953129, 16388712, 16890863, 17587646, 18029454, 18373609, 21298446, 21346151, 22357188, 22596222, 23121518, 23573259 View all (19 more)
Atherosclerosis	Stimulate	16412050, 35941971
Athletic Injuries	Associate	27035221
Atrial Fibrillation	Associate	29375116, 30760287, 33755965
Autistic Disorder	Associate	35082275
Autoimmune Diseases	Associate	24975964, 26830904, 34418898, 35449863
Autoimmune Pancreatitis	Associate	28921377
Axial osteomalacia	Associate	31941549
Bacteremia	Associate	11529488
Bacterial Infections	Associate	12124407, 12796470, 12853386, 15882292, 16219455, 16487238, 16738534, 19502387, 25412934, 36555403
Barrett Esophagus	Associate	27008696
Behcet Syndrome	Associate	18234118, 18336589, 23633568, 23940075, 32756992, 39838177
Bicuspid Aortic Valve Disease	Associate	31363123
Bipolar Disorder	Stimulate	22832610
Bipolar Disorder	Associate	25790282
Blind Loop Syndrome	Associate	30457560
Blood Platelet Disorders	Associate	29383704, 29869943
Bone Diseases	Associate	38367924
Bone Marrow Diseases	Associate	34905501
Bone Resorption	Associate	25931355
Boutonneuse Fever	Associate	16388712
Brachydactyly Type D	Stimulate	28504607
Brain Injuries	Associate	24610929
Brain Ischemia	Associate	26437797
Breast Neoplasms	Associate	20618976, 21129170, 22560646, 23338716, 25274031, 25332681, 25360699, 26063617, 26261595, 26369701, 26392082, 26448179, 27187369, 28212583, 28950845 View all (10 more)
Breast Neoplasms	Stimulate	25332681
Breast Neoplasms	Inhibit	36224342
Bronchiectasis	Stimulate	18684966
Bronchiolitis	Associate	16542364, 29253610, 34332337
Bronchiolitis	Inhibit	19497921
Bronchiolitis Obliterans Syndrome	Associate	19218437, 28341816, 38379280
Bronchitis Chronic	Associate	23514217
Bronchopulmonary Dysplasia	Associate	22348075
Burns	Associate	19060757
Calcinosis	Associate	26515875, 29227975
Calcinosis Cutis	Associate	27008696, 28765705, 29883450
Cancer Pain	Associate	30610800
Candidiasis Oral	Associate	25704085
Carcinogenesis	Associate	20177675, 20618976, 21239458, 23430757, 24518707, 25034527, 25400780, 26158864, 29602239, 29670922, 30710321, 32050430
Carcinogenesis	Stimulate	35955552
Carcinoma Ductal Breast	Associate	23338716
Carcinoma Hepatocellular	Associate	21559380, 23465595, 25034527, 25053598, 25177689, 25179842, 27492456, 29338742, 29602239, 31340754, 31477445, 33576897, 35955552, 36012696, 37554278
Carcinoma Merkel Cell	Associate	30093453
Carcinoma Non Small Cell Lung	Associate	25592377, 31432177, 32367494, 32468028, 35373505
Carcinoma Ovarian Epithelial	Associate	19619321, 22533866, 22985132, 24452475, 24977712, 27118139, 27460076, 29502561
Carcinoma Pancreatic Ductal	Associate	20556833, 30246618, 39518973
Carcinoma Renal Cell	Associate	23816956, 30287405, 32481352, 36932108, 38579915
Carcinoma Squamous Cell	Stimulate	21527067, 23803172
Cardiomegaly	Associate	31681945
Cardiomyopathies	Associate	16714144, 28370906
Cardiomyopathy Dilated	Associate	14688801, 22645142
Cardiomyopathy Dilated with Left Ventricular Noncompaction	Associate	22645142
Cardiomyopathy Hypertrophic	Associate	30309485
Cardiotoxicity	Associate	33046755, 34544967
Cardiovascular Diseases	Associate	22357188, 24803744, 27495090, 29547441, 31328431, 36012132
Cardiovascular Diseases	Inhibit	31336567
Carotid Artery Diseases	Associate	12124407, 15953129, 17587646
Carotid Artery Injuries	Associate	24803744
Carotid Stenosis	Associate	21393601, 25196434, 32076951
Cartilage Diseases	Associate	31715293, 34643941
Celiac Disease	Associate	16984219, 28028951, 30057921
Cerebral Arterial Diseases	Associate	38049739
Cerebral Infarction	Associate	18549840, 21206505, 21236709
Cerebral Infarction	Stimulate	26437797
Chagas Cardiomyopathy	Associate	22302853
Chagas Disease	Associate	18368233
Chemical and Drug Induced Liver Injury	Stimulate	22330637
Chemical and Drug Induced Liver Injury	Associate	24448807
Cholangiocarcinoma	Associate	30457560
Cholestasis	Associate	30141207
Cholesteatoma	Associate	31947538, 32915926, 33627146
Cholesteatoma Middle Ear	Stimulate	31947538
Chronic Disease	Associate	31065010
Chronic Periodontitis	Associate	15664906, 17176826, 24363500, 27411657, 28025440, 30571680
Chronic Periodontitis	Inhibit	16428799
Chronic Urticaria	Associate	21985375, 35659940, 38045687
Chronobiology Disorders	Associate	21466684
Colitis Associated Neoplasms	Associate	28408791
Colitis Ulcerative	Associate	15194649, 16085746, 16840031, 18040078, 20360984, 22185629, 23811547, 24971461, 27895398, 28408791, 29794741, 36768553, 39252247
Colitis Ulcerative	Stimulate	19664152, 24828022, 24971461, 26462859
Colonic Neoplasms	Associate	21054580, 23949880, 28765705, 39223499
Colorectal Neoplasms	Associate	19436306, 19596916, 19760027, 20145615, 21625017, 21792899, 21845432, 22180778, 23071493, 23949880, 24390484, 24446182, 24887394, 24934366, 25705893 View all (20 more)
Colorectal Neoplasms	Stimulate	25547486
Common Variable Immunodeficiency	Associate	29757592, 37626865
Communicable Diseases	Associate	15882292, 16388712, 36135817
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Associate	32765497
Conjunctivitis Allergic	Stimulate	33114004
Constriction Pathologic	Associate	17942642
Corneal Endothelial Cell Loss	Associate	29257294
Corneal Injuries	Associate	32016117
Coronary Aneurysm	Associate	28344199
Coronary Aneurysm	Stimulate	32022379
Coronary Artery Disease	Associate	15725697, 26959040, 28002812, 28092654, 28407320, 33506919, 36184551, 37222220, 38275751
Coronary Artery Disease	Stimulate	16412050, 23121518, 30857550
Coronary Occlusion	Stimulate	20447947
Coronary Occlusion	Associate	31780868
Coronary Stenosis	Associate	19140875, 31780868
COVID 19	Stimulate	32989935, 36651678
COVID 19	Associate	34020127, 34315957, 34643000, 34956213, 35876526, 36052061, 36790534, 36840831, 37686069, 37766191, 38022594, 38029833, 38165854, 39359733
COVID 19	Inhibit	39922089
Coxsackievirus Infections	Associate	36439191
Crisponi syndrome	Inhibit	37335026
Critical Illness	Associate	20957032, 32035159
Crohn Disease	Associate	15194649, 15655821, 15770725, 17538633, 18028374, 18336589, 18680223, 19095953, 21079743, 21157977, 24971461, 26830904, 27895399, 33743589, 35529850, 36462956, 37550393 View all (2 more)
Crohn Disease	Stimulate	18040078, 19664152, 24828022, 37567009
Crohn Disease	Inhibit	32872480
Cushing's symphalangism	Associate	28002812
Cystic Fibrosis	Associate	15661927, 15776129, 16830219, 17890129, 19502387, 22466961, 23316065, 30177416, 31813753
Cystic Fibrosis	Stimulate	18684966, 25329529
Cystitis	Inhibit	19543401
Cystitis	Associate	19543401
Cytokine Release Syndrome	Associate	12853386, 16622205, 16714144, 20618976, 22360682, 23403315, 26202921, 26448179, 29410345, 32674360, 35413908, 38165854, 39359733
Cytokine Release Syndrome	Stimulate	19341426, 29215065, 29227975, 31396221
Cytomegalovirus Infections	Associate	15882292
Death	Associate	28510725, 29253610, 29671417, 36932108
Dental Plaque	Stimulate	26483407, 28344199
Depressive Disorder	Associate	33903586
Depressive Disorder Major	Stimulate	33112414
Dermatitis Atopic	Associate	22032785, 22686584, 22710427, 28593178, 28713916, 35349724
Dermatitis Contact	Associate	37187734
Dermatomyositis	Associate	19953283
Dermatomyositis	Stimulate	25365350
Diabetes Gestational	Stimulate	27340831
Diabetes Gestational	Associate	33019392, 39397405
Diabetes Mellitus	Associate	18306470, 20846165, 21125016, 22357188, 29547441, 30287405, 37773841, 39397405
Diabetes Mellitus Type 1	Stimulate	18029454, 20153491, 33071971
Diabetes Mellitus Type 1	Associate	19455302, 25942429
Diabetes Mellitus Type 2	Associate	18298826, 23465595, 23936790, 24085443, 24883015, 27095356, 30287405, 31065010, 31785408, 36552771, 37830554, 37876569
Diabetes Mellitus Type 2	Stimulate	18633101, 20067962, 24786705, 27904654, 34657898
Diabetes Mellitus Type 2	Inhibit	25959254
Diabetic Foot	Associate	23936790, 39702546
Diabetic Nephropathies	Associate	24786705, 35291915
Diabetic Neuropathies	Associate	27981790
Diabetic Retinopathy	Associate	24883015, 25610879, 28858846, 36506045
Diarrhea	Associate	34583337
Diarrhea	Inhibit	34583337
Diastrophic dysplasia	Associate	30273982
Disease	Associate	30530896, 40084286
Diverticular Diseases	Associate	25133198
Down Syndrome	Stimulate	30390640
Drug Hypersensitivity	Associate	20646366, 26376485, 28593178, 33114004
Drug Related Side Effects and Adverse Reactions	Associate	32028672, 34544967, 40481763
Dysgerminoma	Associate	15331405
Dyslipidemias	Associate	33426065
Emphysema	Associate	22251849, 23170858
Encephalomyelitis Acute Disseminated	Stimulate	33597947
Encephalomyelitis Autoimmune Experimental	Associate	35449863
Endometrial Neoplasms	Associate	18775079, 20646321, 26872033
Endometriosis	Associate	18775079, 36339397, 40187212
Endometritis	Associate	35100093
Endotoxemia	Associate	24846769
Enterocolitis	Associate	34362295
Enterocolitis Necrotizing	Associate	26274503, 29276042, 39342173
Eosinophilia	Associate	25069610
Eosinophilic Esophagitis	Associate	29691386
Eosinophilic Esophagitis	Stimulate	37967572
Epilepsy	Associate	23706953, 29382328, 37946105
Epilepsy Temporal Lobe	Associate	37946105
Epstein Barr Virus Infections	Associate	32753695
Escherichia coli Infections	Associate	31296484, 36555403
Esophageal Achalasia	Associate	27511445
Esophageal Neoplasms	Associate	26369701, 27323819, 28531216, 29670922, 29968427
Esophageal Squamous Cell Carcinoma	Stimulate	21990957
Esophageal Squamous Cell Carcinoma	Associate	29968427
Fabry Disease	Stimulate	31221509
Fatigue	Associate	25542762, 37915075
Fatigue Syndrome Chronic	Associate	19647494, 24054763
Fatty Liver	Associate	31001563
Fatty Liver Alcoholic	Stimulate	24997224
Fetal Membranes Premature Rupture	Associate	37272109
Fever	Stimulate	25256892
Fever	Associate	25412934, 38139402
Fibrocartilaginous embolism	Associate	32841225
Fibrosis	Associate	19586676, 21932384, 22330637, 24349054, 25177689, 25516666, 28418003, 30836660
Focal cortical dysplasia of Taylor	Associate	29382328
Food Hypersensitivity	Inhibit	21071337
Food Hypersensitivity	Associate	37853967
Fractures Bone	Associate	33867845
Frailty	Associate	39464190
Friedreich Ataxia	Associate	39519164
Friedreich Ataxia 1	Associate	22994343
Gallbladder Neoplasms	Associate	21283657
Gastritis	Associate	22468087, 25400780, 28368946, 32719215
Gastroesophageal Reflux	Associate	29968427, 33686512
Gastrointestinal Diseases	Associate	24717721, 29085211
Gingivitis	Associate	17176826, 31448244
Glaucoma Open Angle	Associate	22773901, 27861595, 38240248
Glioblastoma	Associate	21127066, 21705839, 29679017, 31037147, 33476981, 36520928
Glioblastoma	Stimulate	33446690
Glioma	Associate	27669113, 34110366
Glomerulonephritis	Associate	35484716
Glomerulonephritis IGA	Stimulate	19891659, 27818460, 33324395
Glomerulonephritis IGA	Associate	31489594, 32388684
Glut1 Deficiency Syndrome	Stimulate	40495488
Gonorrhea	Associate	24144680
Gout	Associate	26808548
Graft vs Host Disease	Associate	11529488
Gram Negative Bacterial Infections	Associate	24950711
Gram Positive Bacterial Infections	Associate	15194649
Granulomatosis with Polyangiitis	Associate	21412229
Granulosa Cell Tumor	Associate	21616060
Granulosa cell tumor of the ovary	Associate	21616060
Graves Disease	Associate	31554206
Guillain Barre Syndrome	Associate	31019995, 35911688
Head and Neck Neoplasms	Associate	21854645, 30865385
Hearing Disorders	Inhibit	39488053
Hearing Disorders	Associate	39488053, 40023593
Hearing Loss	Associate	22662111, 40023593
Hearing Loss	Stimulate	32553077
Hearing Loss Sensorineural	Stimulate	32553077
Heart Arrest	Stimulate	27260481
Heart Diseases	Associate	27226520
Heart Failure	Associate	16714144, 22645142, 36733418
Helicobacter Infections	Associate	18809506, 30301709, 32719215, 34420402
Helicobacter Infections	Stimulate	25400780
HELLP Syndrome	Associate	18382655, 24612145
Hemangioma Cavernous Central Nervous System	Associate	25472749, 35109870
Hematoma Subdural Chronic	Associate	32479555
Hemochromatosis	Associate	24409064
Hemolytic Uremic Syndrome	Associate	16738534
Hemorrhage	Associate	22300618
Hepatic Encephalopathy	Associate	25516666
Hepatitis Alcoholic	Associate	24997224
Hepatitis B Chronic	Associate	25337250
Hepatitis C	Associate	24349054, 25177689
Hepatitis C Chronic	Associate	19586676, 31962161
Hereditary Renal Cancer Associated 1	Inhibit	28069966
Heredodegenerative Disorders Nervous System	Associate	23684765
HIV Infections	Associate	19855253, 22811411, 23595505, 26492336, 27173197, 27281059, 27495090, 29547441, 30116757, 30147152, 30776150, 31396221, 33350746, 35295030
HIV Infections	Stimulate	22280204, 23576675, 36260448
HIV Seropositivity	Associate	35295030
Huntington Disease	Associate	31724242
Hyperglycemia	Associate	19447045, 21996642, 26959040, 32806763
Hyperglycemia	Stimulate	25610879, 25894202
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	24883015
Hyperlipidemias	Associate	26959040
Hypertension	Stimulate	22533660
Hypertension	Associate	23272070, 25120286, 28359064, 29504915, 30530896
Hypertension Pulmonary	Associate	25050807
Hypertension Pulmonary	Stimulate	25329529
Hypothyroidism Congenital Nongoitrous 2	Stimulate	18775079
Hypoxia	Associate	30226538, 31075559, 32028672, 34299186
Hypoxia	Stimulate	37377965
Hypoxia Brain	Associate	35438581
Idiopathic Interstitial Pneumonias	Stimulate	24613046
Idiopathic Noncirrhotic Portal Hypertension	Associate	21455331, 21932384, 25516666, 27857173
Idiopathic Pulmonary Fibrosis	Associate	24613046
IgA Vasculitis	Associate	15593217, 27818460
Ige Responsiveness Atopic	Associate	22151743
Ileal Diseases	Associate	15770725
Immune System Diseases	Associate	27895398
Immune System Diseases	Stimulate	33114004
Immunologic Deficiency Syndromes	Associate	36462956
Infant Newborn Diseases	Associate	25204207
Infections	Stimulate	14565959, 14738455
Infections	Associate	15194649, 15699327, 15882292, 17588655, 17606598, 20525286, 21159925, 21239458, 22238472, 26589477, 28484092, 31278284, 31296484, 32468028, 33247673, 34420402, 36135817, 38203647 View all (3 more)
Infections	Inhibit	16738534
Infectious Mononucleosis	Stimulate	32753695
Infectious Mononucleosis	Associate	32753695
Infertility	Associate	19218437, 40462131
Infertility Female	Associate	40462131
Inflammation	Associate	12124407, 12438339, 12874320, 15699327, 15986373, 16146574, 16388712, 16714144, 16830219, 16984219, 17513785, 17606598, 17892476, 17942642, 18034897 View all (309 more)
Inflammation	Stimulate	14565959, 16052591, 18234118, 18633101, 19001446, 19195606, 20435021, 20447947, 22965987, 23316065, 23398903, 23861935, 25274031, 25329057, 25442996 View all (7 more)
Inflammation	Inhibit	27274225
Inflammatory Bowel Diseases	Associate	15194649, 15655821, 16840031, 17538633, 17595233, 18040078, 18680223, 19230040, 23239925, 24828022, 26462859, 31063017, 31539144, 32478906, 32661180 View all (6 more)
Inflammatory Bowel Diseases	Stimulate	17991289, 19710105, 23437263
Influenza Human	Inhibit	23552014
Influenza Human	Associate	32035159
Insulin Resistance	Associate	18633101, 21125016, 21952248, 22357188, 23454694, 24043885, 27340831, 28270597, 28858846, 29410345, 29649324, 31162913, 32708841, 33686181, 34034759, 36221354 View all (1 more)
Insulin Resistance	Stimulate	24846769
Intellectual Disability	Associate	30584014
Intervertebral Disc Degeneration	Associate	24997157
Intestinal Atresia	Associate	28246611
Intestinal Diseases	Associate	18336589, 22810014, 25400780
Intracranial Aneurysm	Associate	35833148
Intracranial Arteriosclerosis	Associate	25590839
Invasive Pulmonary Aspergillosis	Associate	21483748, 25766605
Iron Deficiencies	Inhibit	36136589
Iron Overload	Associate	33046755
Irritable Bowel Syndrome	Stimulate	23028414, 27150852, 28246611
Irritable Bowel Syndrome	Associate	33750831, 37404119
Ischemia	Associate	19218437, 38049739
Ischemic Stroke	Associate	24784586
Joint Diseases	Associate	28093922
Keratitis	Associate	31856463
Keratoconus	Stimulate	29021606
Kidney Diseases	Associate	19218437, 21220755, 24773611, 28530841, 29923769, 32388684, 35484716
Kidney Neoplasms	Associate	24786705
Kidney Neoplasms	Inhibit	38579915
Laryngeal Neoplasms	Associate	20164024, 21478107
Lead Poisoning Nervous System	Associate	34580414, 38146363
Learning Disabilities	Associate	30584014
Legg Calve Perthes Disease	Associate	25233690
Legionnaires' Disease	Associate	15699327
Leiomyoma	Associate	26617709
LEOPARD Syndrome	Associate	38049739
Leprosy	Associate	19430824, 28327786, 37187734
Leukemia Biphenotypic Acute	Associate	35345353
Leukemia Lymphocytic Chronic B Cell	Inhibit	28083607
Leukemia Lymphocytic Chronic B Cell	Associate	37626865
Leukemia Monocytic Acute	Associate	32448225
Leukemia Myeloid	Associate	18155167
Leukemia Myeloid Acute	Associate	20814675, 25412934, 33247673, 36076988, 39251712
Leukemia Radiation Induced	Associate	29348414
Leukocytosis	Associate	32753695
Leukopenia	Associate	12853386
Leydig Cell Tumor	Associate	32074942
Lichen Sclerosus et Atrophicus	Stimulate	35399843
Lichenoid Eruptions	Associate	28715461
Light Fixation Seizure Syndrome	Associate	28592438
Liver Cirrhosis	Stimulate	17177978
Liver Cirrhosis	Associate	19586676, 21917890, 24448807, 25177689, 25516666, 26785354, 27399683, 27815256, 34651657, 35916814, 40332363
Liver Cirrhosis Alcoholic	Associate	24260493
Liver Cirrhosis Biliary	Associate	17599732
Liver Diseases	Associate	19586676, 20153491
Liver Failure	Associate	19165171, 31962161, 36012696
Liver Failure Acute	Associate	27284092, 37506138
Liver Neoplasms	Associate	20884065
Low Tension Glaucoma	Associate	23286385
Lung Diseases	Associate	16830219, 28599265, 29337590
Lung Diseases Fungal	Associate	19539691
Lung Diseases Interstitial	Stimulate	24613046
Lung Diseases Interstitial	Associate	32164729
Lung Injury	Associate	24613046
Lung Neoplasms	Associate	24321786, 29788922, 35422093, 37311357, 37443143
Lung Neoplasms	Stimulate	32468028
Lupus Erythematosus Cutaneous	Associate	28530841
Lupus Erythematosus Systemic	Associate	17469140, 19843090, 22932793, 25485543, 28530841, 29061842
Lupus Erythematosus Systemic	Inhibit	21039738
Lupus Erythematosus Systemic	Stimulate	40011954
Lupus Nephritis	Associate	28530841, 31806961
Lupus Vasculitis Central Nervous System	Stimulate	40011954
Lymphatic Metastasis	Associate	21990957, 22180778, 23949880, 25274031, 30066873
Lymphatic Metastasis	Stimulate	22611320, 23338716, 28347236, 29968427
Lymphatic Metastasis	Inhibit	38579915
Lymphoma B Cell	Associate	18820675
Lymphoma B Cell Marginal Zone	Associate	18042837
Lymphoma Large B Cell Diffuse	Associate	16740140
Lymphoma Mantle Cell	Associate	22915070
Lymphoma Non Hodgkin	Associate	16740140, 25422198
Lymphoma T Cell Cutaneous	Stimulate	36265653
Macrophage Activation Syndrome	Associate	37686069
Macular Degeneration	Associate	18172114, 31083239, 31795454
Malaria	Stimulate	26555697
Malaria	Inhibit	27027867
Malignant Teratocarcinosarcoma	Associate	31238737
Malnutrition	Associate	27861595
Marfan Syndrome	Associate	37445606
Maturity Onset Diabetes of the Young Type 8 with Exocrine Dysfunction	Associate	35498402
Medulloblastoma	Associate	24997224
Melanoma	Associate	17156435, 19001446, 21931695, 22552381, 25175033, 29359608, 29486738, 32312954, 36113897, 39266214
Melioidosis	Associate	28628607
Meningism	Associate	32967147
Meningitis Bacterial	Associate	22662111
Meningitis Haemophilus	Associate	32967147
Meningitis Meningococcal	Associate	22662111, 23691182
Meningococcal Infections	Associate	23595505
Mental Disorders	Associate	34267256
Metabolic Diseases	Associate	23239997, 29673059, 37964189
Metabolic Syndrome	Stimulate	22357188, 22991262
Metabolic Syndrome	Associate	26930651, 32708841
Microscopic Polyangiitis	Associate	39672520
Migraine Disorders	Associate	23023380
Mitochondrial Diseases	Associate	35832490
Monocyte Chemotactic Disorder	Associate	27861595
Mouth Diseases	Stimulate	18775079
Movement Disorders	Associate	33112414
Mucocutaneous Lymph Node Syndrome	Associate	28061462, 37773705
Multiple Myeloma	Stimulate	20629663
Multiple Myeloma	Associate	21248470, 26564000, 30280787, 30824741, 36401285
Multiple Organ Failure	Associate	19131814, 24950711, 32035159
Multiple Sclerosis	Associate	19664140, 24975964, 25957268, 26996115, 27036414, 29168181, 33112414, 34418898, 35335126, 37849336
Multiple Sclerosis	Stimulate	30740110
Multiple Sclerosis Relapsing Remitting	Associate	27036414
Multiple System Atrophy	Associate	28234259
Muscle Neoplasms	Associate	28114971
Muscular Atrophy	Associate	37335026
Myasthenia Gravis	Associate	15972959
Myasthenia Gravis	Stimulate	37975358
Myasthenic Syndromes Congenital	Associate	15972959
Mycoses	Associate	12847679, 19539691, 28573109, 31856463
Myelodysplastic Syndromes	Associate	18084608, 23403315, 34130612, 37852977
Myocardial Infarction	Associate	15953129, 16388712, 17587646, 18282141, 18549840, 29375116, 29869943, 32594092, 33506919, 39261934
Myocardial Infarction	Stimulate	23121518
Myocardial Ischemia	Stimulate	26030867
Myocardial Reperfusion Injury	Associate	28341816
Myocarditis	Associate	28370906
Myositis	Stimulate	32164729
Myositis Inclusion Body	Stimulate	25365350
Myositis Ossificans	Associate	34954853
Myotonic Dystrophy	Associate	34830017, 37876569
Nasal Polyps	Stimulate	25973005
Nasopharyngeal Carcinoma	Associate	16969132, 22320262, 33767586, 38567476
Necrosis	Associate	23338716
Neoplasm Metastasis	Associate	20145615, 21931695, 22180778, 23065466, 23338716, 23949880, 24643522, 25053598, 25274031, 25592377, 26261595, 30066873, 30098292, 30203045, 30710321 View all (5 more)
Neoplasm Metastasis	Stimulate	21129170, 37990304
Neoplasm Metastasis	Inhibit	28765705
Neoplasms	Associate	12853386, 16969132, 18825409, 19318560, 19619321, 19826413, 20164024, 20556833, 20618976, 21054580, 21129170, 21239458, 21455638, 21527067, 21559380 View all (74 more)
Neoplasms	Stimulate	20145615, 20978888, 33446690, 35001007, 35874727
Neoplasms	Inhibit	37384650, 38579915
Neoplasms Glandular and Epithelial	Associate	35156897
Nephritis	Associate	36061150
Nephrogenic Fibrosing Dermopathy	Associate	22649203
Nephrosis congenital	Associate	27355219
Nephrosis Lipoid	Stimulate	24786705
Nerve Degeneration	Associate	29671417
Nervous System Diseases	Associate	24803744, 32967147
Neu Laxova syndrome	Associate	36216277
Neuralgia	Associate	34741226, 37175520
Neuroblastoma	Associate	17156435
Neurocysticercosis	Associate	27124018
Neurodegenerative Diseases	Associate	24975964, 30584014
Neuroinflammatory Diseases	Associate	24784586, 29671417, 34104310, 36523959, 37151606, 39183433
Neuromyelitis Optica	Stimulate	35806122
Nocturia	Associate	27243216
Non alcoholic Fatty Liver Disease	Associate	18641190, 26629827, 26930651, 27895422, 29673059, 32594092
Non alcoholic Fatty Liver Disease	Stimulate	26113297, 31388096
Nose Diseases	Associate	15557653, 31304782
Obesity	Associate	17381056, 19564704, 20846165, 20930711, 21125016, 21461352, 21952248, 23188427, 24929539, 26113297, 27481183, 29410345, 29802748, 31825075, 32615574 View all (7 more)
Obesity	Stimulate	18633101, 27535280, 28320058, 30287405
Obesity	Inhibit	31936430
Obesity Abdominal	Associate	37571378
Obesity Maternal	Associate	20818954
Obesity Metabolically Benign	Associate	34230580
Oculocutaneous albinism type 2	Associate	30246618
Oncogene Addiction	Associate	20145615
Opportunistic Infections	Associate	15882292
Opportunistic Infections	Stimulate	21406030
Optic Neuritis	Associate	36969199
Oral Ulcer	Associate	37653793
Osteoarthritis	Associate	18584044, 23776688, 23776697, 28093922, 32095874, 32410875, 33174011, 34643941, 35993243, 36108390
Osteoarthritis Knee	Stimulate	28093922, 36216277
Osteomyelitis	Associate	16487238, 37459905
Osteoporosis	Associate	17381056, 33867845, 38367924
Osteosarcoma	Associate	34588497
Otitis	Inhibit	24434259
Otitis Media	Associate	21857919, 23576001, 23929584, 26177520, 26496338
Otitis Media with Effusion	Associate	23929584
Ovarian Diseases	Associate	33370338, 40462131
Ovarian Neoplasms	Associate	19826413, 22528050, 27059733, 27118139, 29502561, 30610800, 31655274, 32878513, 33370338, 36231099, 38103365
Overweight	Associate	23239997, 37571378
Pain	Associate	24997157
Pancreatic Neoplasms	Associate	27941651, 30246618, 30457560, 33939664, 34502140, 36232715
Pancreatitis	Associate	39221252
Papilloma	Associate	32066304
Papillomavirus Infections	Associate	21527067, 31278284, 33164635, 36915050, 39273663
Parkinson Disease	Stimulate	29670828, 32006615
Parkinson Disease	Associate	33272323, 37408202
Parkinson Disease	Inhibit	35026420
Pediatric Obesity	Associate	36935364
Pelvic Inflammatory Disease	Associate	22238472
Peptic Ulcer	Associate	26161647, 34420402
Peri Implantitis	Associate	34931168, 38597081
Periapical Diseases	Associate	26708181, 27031066
Periapical Granuloma	Stimulate	26708181
Periodic fever familial autosomal dominant	Associate	31429073
Periodontal Diseases	Associate	14738464, 19118102, 20546116
Periodontitis	Associate	14738464, 18328075, 19118102, 22661708, 23981212, 26581717, 27411657, 31196168, 31281226, 34174589, 38270303, 39266981
Periodontitis	Stimulate	38007427
Peripheral Arterial Disease	Associate	16890863, 24472415
Peripheral Nervous System Diseases	Stimulate	27981790
Peritoneal Neoplasms	Associate	30610800
Personality Disorders	Associate	24030146
Placenta Diseases	Associate	20614721
Plaque Atherosclerotic	Associate	18837796, 23023379, 23573259, 25196434, 25757594
Pneumonia	Associate	20525286, 24321282, 31066476, 33247673, 34603755, 35345353, 35832490, 36135817, 36530439, 37766191
Pneumonia	Stimulate	25550856
Pneumonia Bacterial	Associate	29547441
Pneumonia Mycoplasma	Stimulate	26191227
Pneumonia Staphylococcal	Associate	27615723
Pneumonia Ventilator Associated	Associate	20525286
Polycystic Ovary Syndrome	Associate	34279173, 36221354
Polymyositis	Associate	19953283
Polymyositis	Stimulate	25365350
Polysaccharide Storage of Unusual	Associate	22226452
Porphyria Variegate	Stimulate	33255933
Post Acute COVID 19 Syndrome	Associate	37915075
Post Infectious Disorders	Stimulate	28410580
Pre Eclampsia	Associate	18382655, 20818954, 24612145, 28558299, 31477211
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	35345353
Premature Birth	Associate	34195300
Primary Graft Dysfunction	Stimulate	28341816
Primary Immunodeficiency Diseases	Associate	36462956
Primary Myelofibrosis	Associate	34905501
Prodromal Symptoms	Associate	30246618
Prostatic Hyperplasia	Associate	27243216
Prostatic Neoplasms	Associate	19267370, 20978888, 21563195, 23179660, 30098292, 36165000, 36257875, 38583012
Prostatic Neoplasms	Stimulate	38376283
Prostatitis	Associate	19267370, 20978888
Proteinuria	Associate	19891659, 31489594
Pruritus	Associate	37681909
Pseudomonas Infections	Associate	20570573
Psoriasis	Associate	26830904, 33416099
Pulmonary Arterial Hypertension	Associate	28359064, 32712618
Pulmonary Disease Chronic Obstructive	Inhibit	16004610, 18034897
Pulmonary Disease Chronic Obstructive	Associate	16219455, 21439805, 21483784, 22070100, 22952638, 23170858, 26498252, 27442627, 28025440, 28260877, 28536249, 28537664, 29535517, 31640653, 33244226
Pulmonary Disease Chronic Obstructive	Stimulate	22438960, 23374856, 23514217, 30133616, 33590951
Pulmonary Emphysema	Associate	22251849
Purpura Thrombocytopenic Idiopathic	Associate	20626741, 31858561, 31903617
Purpura Thrombocytopenic Idiopathic	Inhibit	28412855
Purpura Thrombocytopenic Idiopathic	Stimulate	35796625
Pyelonephritis	Associate	19543401
Q Fever	Associate	40333225
Radiation Pneumonitis	Associate	25550856
Radicular Cyst	Stimulate	26708181
Rectal Neoplasms	Associate	24446182
Renal Insufficiency Chronic	Associate	16738534, 32649699
Reperfusion Injury	Associate	19218437, 31075559
Reproductive Tract Infections	Associate	26617709, 40462131
Respiratory Distress Syndrome	Inhibit	20600872
Respiratory Distress Syndrome	Associate	23239500, 29337590, 31261506, 34956213, 37477094, 38029833
Respiratory Insufficiency	Associate	23514217, 27615723, 32035159
Respiratory Syncytial Virus Infections	Associate	18776592, 22348075
Respiratory Tract Infections	Associate	29486764
Retinal Diseases	Associate	40495488
Retinal Dysplasia	Associate	27008696
Retinopathy of Prematurity	Associate	40084286
Retroperitoneal Fibrosis	Associate	23690937
Rheumatic Diseases	Associate	31715293
Rhinitis Allergic	Associate	16146574
Rickettsia Infections	Associate	16388712
Rigid spine syndrome	Associate	24997224
Sarcoidosis	Associate	16487240, 16879239, 18422738, 20851927
Sarcopenia	Associate	24846769, 32226296
Schizophrenia	Inhibit	30630651
Schizophrenia	Associate	35027554, 37511534, 38102721
Sciatica	Associate	33535986, 33573686
Scleroderma Diffuse	Associate	33809015
Scleroderma Systemic	Associate	27815256, 31545397, 33168071
Seizures	Associate	23706953, 27124018
Sepsis	Associate	12796470, 17210974, 19131814, 21466684, 23825193, 24950711, 25412934, 27615723, 27861595, 32513051, 32989935, 33247673, 34689707, 34733114, 35345353, 36135817, 36344490 View all (2 more)
Severe Acute Respiratory Syndrome	Associate	26701820, 33755043
Severe Fever with Thrombocytopenia Syndrome	Associate	26701820
Shock	Associate	19131814
Silicosis	Associate	30013439
Sjogren's Syndrome	Stimulate	34149728
Skin Diseases	Associate	28530841, 28713916
Skin Manifestations	Associate	28530841
Skin Neoplasms	Associate	39684439
Sleep Apnea Obstructive	Associate	32028672, 36479843
Sleep Apnea Obstructive	Stimulate	32076951
Sleep Deprivation	Stimulate	25373853
Sleep Deprivation	Associate	26979829
Sleep Initiation and Maintenance Disorders	Inhibit	25749595
Sleep Initiation and Maintenance Disorders	Associate	30140039
Smoke Inhalation Injury	Associate	32929038
Spinal Cord Injuries	Associate	33863336
Spondylarthropathies	Stimulate	15986373
Spondylitis Ankylosing	Associate	16277694, 25506924, 38019769
Spondylitis Ankylosing	Stimulate	17459079, 20952467
Squamous Cell Carcinoma of Head and Neck	Associate	19318560, 21854645, 22583829, 24518707, 26709642, 27191981, 34158059
Squamous Cell Carcinoma of Head and Neck	Inhibit	35310196
Squamous Cell Carcinoma of Head and Neck	Stimulate	35327577
ST Elevation Myocardial Infarction	Stimulate	23121518
Status Asthmaticus	Stimulate	20816188, 21570715, 27084682
Status Asthmaticus	Associate	21905500, 26191227, 27495363, 32338995, 34621380, 37996952
Stenotrophomonas maltophilia bacteremia	Associate	12796470
Still's Disease Adult Onset	Associate	27537874, 31101882, 35715478
Stomach Diseases	Associate	21455638, 22354030, 25873761, 26161647, 30301709, 32719215
Stomach Neoplasms	Associate	17462092, 18826495, 19189651, 22468087, 22611320, 23776537, 24030146, 24446182, 24929539, 26675260, 28275299, 28347236, 29670922, 29762851, 30292233 View all (6 more)
Stomatitis Aphthous	Associate	39343890
Stroke	Associate	21206505, 21236709, 30760287
Subarachnoid Hemorrhage	Associate	26437797
Surgical Wound Infection	Associate	36135817
Synovitis	Associate	33377396
Systemic Inflammatory Response Syndrome	Associate	20634913
Takayasu Arteritis	Stimulate	35126357
talaromycosis	Associate	33777838
Tendinopathy	Associate	19148938
Tertiary Lymphoid Structures	Stimulate	23949880
Tertiary Lymphoid Structures	Associate	23949880
Tertiary Lymphoid Structures	Inhibit	36281585
Testicular Germ Cell Tumor	Associate	23300844
Thrombocythemia Essential	Associate	32425934
Thrombosis	Associate	29383704
Thymoma	Associate	37975358
Thyroid Carcinoma Anaplastic	Associate	37990304
Tonsillar Neoplasms	Associate	21159925
Tonsillitis	Associate	21159925
Transfusion Related Acute Lung Injury	Associate	36004763
Triple Negative Breast Neoplasms	Associate	39819723
Tuberculosis	Associate	23766695, 24727508, 27339100, 30481307, 32411792, 35295030, 37460564
Tuberculosis Meningeal	Associate	26567164
Tuberculosis Meningeal	Stimulate	36260448
Tuberculosis Pleural	Associate	17709420
Tuberculosis Pulmonary	Associate	19575238, 23766695, 24727508, 27339100, 31640653, 35295030, 37460564
Turcot syndrome	Associate	35789992
Ulcer	Associate	18336589
Ureteral Obstruction	Associate	23690937
Urinary Bladder Neoplasms	Associate	18825409, 23065466, 25472584, 26634514, 38554019
Urinary Bladder Neoplasms	Inhibit	24606459
Urinary Tract Infections	Associate	27252945
Uterine Cervical Dysplasia	Inhibit	20177675
Uterine Cervical Dysplasia	Stimulate	21527067
Uterine Cervical Neoplasms	Associate	20177675, 26548749, 28402258, 28626766, 28653898, 29207048, 31278284, 37400149, 39208235
Uterine Cervical Neoplasms	Stimulate	31278284
Uterine Cervicitis	Associate	21527067, 31365550, 36915050
Uterine Diseases	Associate	18775079
Vaginosis Bacterial	Associate	19554026, 23021866
Vascular Calcification	Associate	21325271
Vascular Calcification	Stimulate	29227975
Vascular Diseases	Associate	31782253, 32954825
Vascular Remodeling	Associate	25120286, 30133616
Vascular System Injuries	Associate	28858846, 36717098
Vasculitis	Associate	21915309, 24773611, 29923769
Vasospasm Intracranial	Associate	26437797
Venous Thrombosis	Associate	23690937
Ventricular Dysfunction Left	Associate	26030867, 33046755
Viremia	Associate	22811411
Virus Diseases	Associate	20702616
Vitamin D Deficiency	Associate	37964189
von Willebrand Disease Type 2	Stimulate	25365350
Weight Loss	Stimulate	18535122
Weight Loss	Associate	27897403
Wounds and Injuries	Associate	20929567, 24069659, 25790282, 28255201, 35156897, 35291915, 35993243, 38007427
Wounds and Injuries	Stimulate	34172608

TLR4 (toll like receptor 4)