Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7091
Gene name Gene Name - the full gene name approved by the HGNC.	TLE family member 4, transcriptional corepressor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TLE4
Synonyms (NCBI Gene) Gene synonyms aliases	BCE-1, BCE1, E(spI), E(spl), ESG, ESG4, GRG4, Grg-4
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q21.31

Show/Hide all(115)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005105	hsa-miR-155-5p	Microarray	19193853
MIRT016236	hsa-miR-548b-3p	Sequencing	20371350
MIRT017745	hsa-miR-335-5p	Microarray	18185580
MIRT005105	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT021114	hsa-miR-186-5p	Sequencing	20371350
MIRT027063	hsa-miR-103a-3p	Sequencing	20371350
MIRT029323	hsa-miR-26b-5p	Microarray	19088304
MIRT031643	hsa-miR-16-5p	Sequencing	20371350
MIRT032123	hsa-let-7d-5p	Sequencing	20371350
MIRT046892	hsa-miR-221-3p	CLASH	23622248
MIRT041429	hsa-miR-193b-3p	CLASH	23622248
MIRT726317	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT726318	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT031643	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT726316	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT1426331	hsa-miR-124	CLIP-seq
MIRT1426332	hsa-miR-1264	CLIP-seq
MIRT1426333	hsa-miR-15a	CLIP-seq
MIRT1426334	hsa-miR-15b	CLIP-seq
MIRT1426335	hsa-miR-16	CLIP-seq
MIRT1426336	hsa-miR-195	CLIP-seq
MIRT1426337	hsa-miR-3127-5p	CLIP-seq
MIRT1426338	hsa-miR-3613-3p	CLIP-seq
MIRT1426339	hsa-miR-424	CLIP-seq
MIRT1426340	hsa-miR-4270	CLIP-seq
MIRT1426341	hsa-miR-4441	CLIP-seq
MIRT1426342	hsa-miR-4524	CLIP-seq
MIRT1426343	hsa-miR-497	CLIP-seq
MIRT1426344	hsa-miR-499-3p	CLIP-seq
MIRT1426345	hsa-miR-499a-3p	CLIP-seq
MIRT1426346	hsa-miR-503	CLIP-seq
MIRT1426347	hsa-miR-506	CLIP-seq
MIRT1426348	hsa-miR-513a-3p	CLIP-seq
MIRT1426349	hsa-miR-545	CLIP-seq
MIRT1426350	hsa-miR-548ac	CLIP-seq
MIRT1426351	hsa-miR-548an	CLIP-seq
MIRT1426352	hsa-miR-548d-3p	CLIP-seq
MIRT1426353	hsa-miR-548z	CLIP-seq
MIRT1426354	hsa-miR-640	CLIP-seq
MIRT1426355	hsa-miR-646	CLIP-seq
MIRT1557192	hsa-miR-3617	CLIP-seq
MIRT1557193	hsa-miR-641	CLIP-seq
MIRT2349492	hsa-miR-1208	CLIP-seq
MIRT2349493	hsa-miR-1279	CLIP-seq
MIRT2349494	hsa-miR-137	CLIP-seq
MIRT2349495	hsa-miR-2115	CLIP-seq
MIRT2349496	hsa-miR-3977	CLIP-seq
MIRT2349497	hsa-miR-4420	CLIP-seq
MIRT2349498	hsa-miR-4716-5p	CLIP-seq
MIRT1426344	hsa-miR-499-3p	CLIP-seq
MIRT1426345	hsa-miR-499a-3p	CLIP-seq
MIRT2349499	hsa-miR-5096	CLIP-seq
MIRT2349500	hsa-miR-516a-3p	CLIP-seq
MIRT2349501	hsa-miR-944	CLIP-seq
MIRT2434048	hsa-miR-106a	CLIP-seq
MIRT2434049	hsa-miR-106b	CLIP-seq
MIRT2434050	hsa-miR-17	CLIP-seq
MIRT2434051	hsa-miR-20a	CLIP-seq
MIRT2434052	hsa-miR-20b	CLIP-seq
MIRT2434053	hsa-miR-2116	CLIP-seq
MIRT2434054	hsa-miR-302a	CLIP-seq
MIRT2434055	hsa-miR-302b	CLIP-seq
MIRT2434056	hsa-miR-302c	CLIP-seq
MIRT2434057	hsa-miR-302d	CLIP-seq
MIRT2434058	hsa-miR-302e	CLIP-seq
MIRT2434059	hsa-miR-3150b-3p	CLIP-seq
MIRT2434060	hsa-miR-3691-3p	CLIP-seq
MIRT2434061	hsa-miR-372	CLIP-seq
MIRT2434062	hsa-miR-373	CLIP-seq
MIRT2434063	hsa-miR-374a	CLIP-seq
MIRT2434064	hsa-miR-374b	CLIP-seq
MIRT2434065	hsa-miR-374c	CLIP-seq
MIRT2434066	hsa-miR-411	CLIP-seq
MIRT2434067	hsa-miR-4434	CLIP-seq
MIRT2434068	hsa-miR-4459	CLIP-seq
MIRT2434069	hsa-miR-4516	CLIP-seq
MIRT2434070	hsa-miR-4677-5p	CLIP-seq
MIRT2434071	hsa-miR-4699-5p	CLIP-seq
MIRT2349498	hsa-miR-4716-5p	CLIP-seq
MIRT2434072	hsa-miR-4784	CLIP-seq
MIRT2434073	hsa-miR-513a-5p	CLIP-seq
MIRT2434074	hsa-miR-519d	CLIP-seq
MIRT2434075	hsa-miR-520a-3p	CLIP-seq
MIRT2434076	hsa-miR-520b	CLIP-seq
MIRT2434077	hsa-miR-520c-3p	CLIP-seq
MIRT2434078	hsa-miR-520d-3p	CLIP-seq
MIRT2434079	hsa-miR-520e	CLIP-seq
MIRT2434080	hsa-miR-520g	CLIP-seq
MIRT2434081	hsa-miR-520h	CLIP-seq
MIRT2434082	hsa-miR-622	CLIP-seq
MIRT2434083	hsa-miR-655	CLIP-seq
MIRT2434084	hsa-miR-665	CLIP-seq
MIRT2434085	hsa-miR-765	CLIP-seq
MIRT2434086	hsa-miR-93	CLIP-seq
MIRT2441299	hsa-miR-183	CLIP-seq
MIRT1426337	hsa-miR-3127-5p	CLIP-seq
MIRT1557192	hsa-miR-3617	CLIP-seq
MIRT2441300	hsa-miR-3657	CLIP-seq
MIRT1426340	hsa-miR-4270	CLIP-seq
MIRT1426341	hsa-miR-4441	CLIP-seq
MIRT2441301	hsa-miR-4669	CLIP-seq
MIRT1557193	hsa-miR-641	CLIP-seq
MIRT2441299	hsa-miR-183	CLIP-seq
MIRT2442747	hsa-miR-208a	CLIP-seq
MIRT2442748	hsa-miR-208b	CLIP-seq
MIRT1426337	hsa-miR-3127-5p	CLIP-seq
MIRT1557192	hsa-miR-3617	CLIP-seq
MIRT2441300	hsa-miR-3657	CLIP-seq
MIRT2442749	hsa-miR-3913-3p	CLIP-seq
MIRT1426340	hsa-miR-4270	CLIP-seq
MIRT1426341	hsa-miR-4441	CLIP-seq
MIRT2441301	hsa-miR-4669	CLIP-seq
MIRT2442750	hsa-miR-489	CLIP-seq
MIRT2442751	hsa-miR-499-5p	CLIP-seq
MIRT1557193	hsa-miR-641	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0003682	Function	Chromatin binding	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0005515	Function	Protein binding	IPI	24676634, 32296183
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	1303260
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990907	Component	Beta-catenin-TCF complex	IDA	28296634

MIM	HGNC	e!Ensembl
605132	11840	ENSG00000106829

Protein

UniProt ID

Q04727

Protein name

Transducin-like enhancer protein 4 (Grg-4) (Groucho-related protein 4)

Protein function

Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by PAX5, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be mo

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03920	TLE_N	8 → 138	Groucho/TLE N-terminal Q-rich domain	Family
PF00400	WD40	571 → 605	WD domain, G-beta repeat	Repeat
PF00400	WD40	609 → 647	WD domain, G-beta repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: In all tissues examined, mostly in brain, and muscle.

Sequence

MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEK
TEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQV
TMAELNAIIGQQLQAQHLSHGHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGGQS
HLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGAEKHRNSADYSSESKKQKTEEKEIA
ARYDSDGEKSDDNLVVDVSNEDPSSPRGSPAHSPRENGLDKTRLLKKDAPISPASIASSS
STPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLASSL
RTPMAVPCPYPTPFGIVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSP
VVGFDPHHHMRVPAIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQ
INTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCR
LLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGN
IAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFT
SQIFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLHESCVLSLKFAHCGKWFVSTG
KDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY

Sequence length

773

Interactions

View interactions

	KEGG		Reactome
	Wnt signaling pathway Notch signaling pathway		Formation of the beta-catenin:TCF transactivating complex Deactivation of the beta-catenin transactivating complex Repression of WNT target genes

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bipolar Disorder	Bipolar disorder	N/A	N/A	GWAS
Diabetes	Severe insulin-resistant type 2 diabetes	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	34438242
Colorectal Neoplasms	Associate	36171645, 38092774, 40473764
Focal Cortical Dysplasia	Associate	24252438
Inflammation	Associate	27486062
Leukemia	Associate	27486062
Leukemia Myeloid	Associate	27486062
Neoplasm Metastasis	Associate	28121627
Neoplasms	Inhibit	27486062
Neoplastic Syndromes Hereditary	Associate	2472742

TLE4 (TLE family member 4, transcriptional corepressor)