Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7088
Gene name Gene Name - the full gene name approved by the HGNC.	TLE family member 1, transcriptional corepressor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TLE1
Synonyms (NCBI Gene) Gene synonyms aliases	ESG, ESG1, GRG1, TLE-1
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q21.32

Show/Hide all(65)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007104	hsa-miR-657	Luciferase reporter assay, Western blot	23175432
MIRT007104	hsa-miR-657	Luciferase reporter assay, Western blot	23175432
MIRT021488	hsa-miR-191-5p	Sequencing	20371350
MIRT042606	hsa-miR-423-3p	CLASH	23622248
MIRT039611	hsa-miR-615-3p	CLASH	23622248
MIRT1426228	hsa-miR-125a-3p	CLIP-seq
MIRT1426229	hsa-miR-1270	CLIP-seq
MIRT1426230	hsa-miR-1283	CLIP-seq
MIRT1426231	hsa-miR-1294	CLIP-seq
MIRT1426232	hsa-miR-184	CLIP-seq
MIRT1426233	hsa-miR-2276	CLIP-seq
MIRT1426234	hsa-miR-3136-3p	CLIP-seq
MIRT1426235	hsa-miR-3164	CLIP-seq
MIRT1426236	hsa-miR-328	CLIP-seq
MIRT1426237	hsa-miR-3545-3p	CLIP-seq
MIRT1426238	hsa-miR-3609	CLIP-seq
MIRT1426239	hsa-miR-3668	CLIP-seq
MIRT1426240	hsa-miR-4272	CLIP-seq
MIRT1426241	hsa-miR-4531	CLIP-seq
MIRT1426242	hsa-miR-4708-3p	CLIP-seq
MIRT1426243	hsa-miR-494	CLIP-seq
MIRT1426244	hsa-miR-520d-5p	CLIP-seq
MIRT1426245	hsa-miR-524-5p	CLIP-seq
MIRT1426246	hsa-miR-544	CLIP-seq
MIRT1426247	hsa-miR-548ah	CLIP-seq
MIRT1426248	hsa-miR-552	CLIP-seq
MIRT1426249	hsa-miR-620	CLIP-seq
MIRT2127694	hsa-miR-1244	CLIP-seq
MIRT2127695	hsa-miR-3134	CLIP-seq
MIRT2127696	hsa-miR-3655	CLIP-seq
MIRT2127697	hsa-miR-4534	CLIP-seq
MIRT1426246	hsa-miR-544	CLIP-seq
MIRT2642789	hsa-miR-1273d	CLIP-seq
MIRT2642790	hsa-miR-1468	CLIP-seq
MIRT2642791	hsa-miR-1587	CLIP-seq
MIRT2642792	hsa-miR-186	CLIP-seq
MIRT2642793	hsa-miR-1912	CLIP-seq
MIRT2642794	hsa-miR-2355-5p	CLIP-seq
MIRT2642795	hsa-miR-3607-5p	CLIP-seq
MIRT2642796	hsa-miR-3614-5p	CLIP-seq
MIRT2642797	hsa-miR-4326	CLIP-seq
MIRT2642798	hsa-miR-4492	CLIP-seq
MIRT2642799	hsa-miR-4498	CLIP-seq
MIRT2642800	hsa-miR-4656	CLIP-seq
MIRT2642801	hsa-miR-4675	CLIP-seq
MIRT1426242	hsa-miR-4708-3p	CLIP-seq
MIRT2642802	hsa-miR-4741	CLIP-seq
MIRT2642803	hsa-miR-4749-3p	CLIP-seq
MIRT2642804	hsa-miR-4785	CLIP-seq
MIRT2642805	hsa-miR-635	CLIP-seq
MIRT2642806	hsa-miR-762	CLIP-seq
MIRT2642791	hsa-miR-1587	CLIP-seq
MIRT2642792	hsa-miR-186	CLIP-seq
MIRT2642793	hsa-miR-1912	CLIP-seq
MIRT2642794	hsa-miR-2355-5p	CLIP-seq
MIRT2642795	hsa-miR-3607-5p	CLIP-seq
MIRT2642796	hsa-miR-3614-5p	CLIP-seq
MIRT2642798	hsa-miR-4492	CLIP-seq
MIRT2642799	hsa-miR-4498	CLIP-seq
MIRT2642800	hsa-miR-4656	CLIP-seq
MIRT2642801	hsa-miR-4675	CLIP-seq
MIRT1426242	hsa-miR-4708-3p	CLIP-seq
MIRT2642802	hsa-miR-4741	CLIP-seq
MIRT2642805	hsa-miR-635	CLIP-seq
MIRT2642806	hsa-miR-762	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
HHEX	Unknown	15187083

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003714	Function	Transcription corepressor activity	IBA	21873635
GO:0003714	Function	Transcription corepressor activity	IDA	10748198
GO:0005515	Function	Protein binding	IPI	9751710, 10748198, 12441302, 17680780, 21699783, 22439931, 24596249, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	10748198
GO:0005634	Component	Nucleus	IMP	22952044
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA	21873635
GO:0005829	Component	Cytosol	IMP	22952044
GO:0007165	Process	Signal transduction	TAS	8808280
GO:0007275	Process	Multicellular organism development	TAS	8365415
GO:0008134	Function	Transcription factor binding	IDA	9751710
GO:0008134	Function	Transcription factor binding	IPI	8687460
GO:0009887	Process	Animal organ morphogenesis	TAS	8808280
GO:0010628	Process	Positive regulation of gene expression	IMP	15006356
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	NAS	9751710
GO:0042802	Function	Identical protein binding	IPI	24596249
GO:0043124	Process	Negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	17680780
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	9751710
GO:0070491	Function	Repressing transcription factor binding	IBA	21873635
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA	21873635
GO:1904837	Process	Beta-catenin-TCF complex assembly	TAS
GO:1990907	Component	Beta-catenin-TCF complex	IDA	28296634
GO:2000811	Process	Negative regulation of anoikis	IMP	15006356, 22952044

MIM	HGNC	e!Ensembl
600189	11837	ENSG00000196781

Protein

UniProt ID

Q04724

Protein name

Transducin-like enhancer protein 1 (E(Sp1) homolog) (Enhancer of split groucho-like protein 1) (ESG1)

Protein function

Transcriptional corepressor that binds to a number of transcription factors. Inhibits NF-kappa-B-regulated gene expression. Inhibits the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. Enhance

PDB

1GXR , 2CE8 , 2CE9 , 4OM2 , 4OM3 , 5MWJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03920	TLE_N	1 → 133	Groucho/TLE N-terminal Q-rich domain	Family
PF00400	WD40	568 → 602	WD domain, G-beta repeat	Repeat
PF00400	WD40	606 → 644	WD domain, G-beta repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: In all tissues examined, mostly in brain, liver and muscle.

Sequence

MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELN
AIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSAGLLALSSALSGQSHLAIK
DDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVDDKDSSHYDSD
GDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLKKDASSSPASTASSASSTSLK
SKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRT
PLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVG
FDPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINT
LNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLP
DGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAV
WDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQI
FSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDN
LLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY

Sequence length

770

Interactions

View interactions

	KEGG		Reactome
	Wnt signaling pathway Notch signaling pathway		Formation of the beta-catenin:TCF transactivating complex Deactivation of the beta-catenin transactivating complex Repression of WNT target genes

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder		17387319	ClinVar
Movement Disorders	movement disorder			GenCC
Diabetes	Diabetes			GWAS
Schizophrenia	Schizophrenia			GWAS
Rheumatoid arthritis	Rheumatoid arthritis			GWAS
Ovarian cancer	Ovarian cancer	Conditional KD of IL6 in the OCCA xenograft model delays tumor growth		GWAS, CBGDA

Show/Hide Text Mining Associations (28)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	30053869
Adenocarcinoma of Lung	Associate	37965333, 40482589
Adenoma	Associate	30053869
Asthma	Associate	28599074
Autism Spectrum Disorder	Associate	24650168
Bipolar Disorder	Inhibit	17553960
Brain Neoplasms	Associate	29316219
Breast Neoplasms	Associate	21536917, 22952044
Carcinoma Hepatocellular	Associate	12079511
Carcinoma Non Small Cell Lung	Associate	27557513, 37848553
Drug Related Side Effects and Adverse Reactions	Associate	21319215
Esophageal Neoplasms	Associate	33794814
Glioblastoma	Associate	29316219
Hypoglycemia	Associate	33353041
Leukemia Lymphocytic Chronic B Cell	Associate	12079511
Liver Neoplasms	Associate	12079511
Lung Neoplasms	Associate	25446087, 27655370, 37965333
Neoplasm Metastasis	Associate	37848553
Neoplasms	Associate	21183761, 22952044, 23287123, 26250366, 27401493, 28817404, 29316219, 30179902, 31702654, 32557980, 33987888, 35125107, 35568949, 35639915, 35710690, 37202095, 38050902 View all (2 more)
Neurilemmoma	Associate	19363472, 23287123
Neurofibrosarcoma	Associate	19363472
Neuroma Acoustic	Associate	31309113
Ovarian Diseases	Associate	27557513
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	34048198
Sarcoma Ewing	Stimulate	23287123
Sarcoma Synovial	Associate	21319215, 23287123, 23929265, 24436244, 26434872, 27120803, 27401493, 27568668
Squamous Cell Carcinoma of Head and Neck	Associate	33000257
Stomach Neoplasms	Associate	31050210

TLE1 (TLE family member 1, transcriptional corepressor)