Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7076
Gene name Gene Name - the full gene name approved by the HGNC.	TIMP metallopeptidase inhibitor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TIMP1
Synonyms (NCBI Gene) Gene synonyms aliases	CLGI, EPA, EPO, HCI, TIMP, TIMP-1
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xp11.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory ro

Show/Hide all(9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006638	hsa-miR-519a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22262409
MIRT028755	hsa-miR-26b-5p	Microarray	19088304
MIRT052992	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22492871
MIRT437506	hsa-miR-1293	Luciferase reporter assay, Western blot	23943285
MIRT731726	hsa-miR-377-3p	Luciferase reporter assay, qRT-PCR, Western blot	25998046
MIRT731726	hsa-miR-377-3p	Luciferase reporter assay, qRT-PCR, Western blot	25998046
MIRT732631	hsa-miR-138-5p	Immunohistochemistry (IHC), Luciferase reporter assay, Western blotting	33733597
MIRT1554770	hsa-miR-2115	CLIP-seq
MIRT1554771	hsa-miR-4436b-5p	CLIP-seq

Transcription factors

Show/Hide all(19)

Transcription factor	Regulation	Reference
ASH1L	Unknown	22488473
FOSB	Repression	11337499
FOSB	Unknown	10051488
FOSL2	Repression	11337499
JUND	Unknown	10051488;11337499
NFKB1	Repression	14600595
NFKB1	Unknown	11426939
PAX5	Activation	22105368
PPARD	Activation	17511960
RELA	Repression	14600595
RUNX1	Unknown	15051730
RUNX3	Activation	21128246
SP1	Activation	11830330
SP1	Unknown	15048879;22415074
SP3	Unknown	11830330
STAT1	Unknown	11918744
STAT3	Activation	15161657
STAT3	Unknown	11918744;15920698
TWIST1	Repression	19513566

Show/Hide all(42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IEA
GO:0002248	Process	Connective tissue replacement involved in inflammatory response wound healing	IEA
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0005125	Function	Cytokine activity	IDA	3839290
GO:0005515	Function	Protein binding	IPI	2251898, 16917503, 20979576, 28030805
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	1653055
GO:0005576	Component	Extracellular region	TAS
GO:0005604	Component	Basement membrane	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	3903517
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IBA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IDA	3903517, 12714508
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IEA
GO:0008270	Function	Zinc ion binding	IDA	22427646
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	3839290
GO:0009725	Process	Response to hormone	IBA
GO:0010951	Process	Negative regulation of endopeptidase activity	IDA	3903517
GO:0030414	Function	Peptidase inhibitor activity	IDA	9573338
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0031012	Component	Extracellular matrix	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0034097	Process	Response to cytokine	IBA
GO:0034097	Process	Response to cytokine	IEA
GO:0034774	Component	Secretory granule lumen	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043086	Process	Negative regulation of catalytic activity	IDA	3903517
GO:0043434	Process	Response to peptide hormone	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051045	Process	Negative regulation of membrane protein ectodomain proteolysis	IBA
GO:0051045	Process	Negative regulation of membrane protein ectodomain proteolysis	IDA	12714508
GO:0051216	Process	Cartilage development	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071492	Process	Cellular response to UV-A	IDA	31380578
GO:1901164	Process	Negative regulation of trophoblast cell migration	IMP	21356369
GO:1901653	Process	Cellular response to peptide	IEA
GO:1905049	Process	Negative regulation of metallopeptidase activity	IDA	9573338
GO:2001044	Process	Regulation of integrin-mediated signaling pathway	IMP	16917503

MIM	HGNC	e!Ensembl
305370	11820	ENSG00000102265

Protein

UniProt ID

P01033

Protein name

Metalloproteinase inhibitor 1 (Erythroid-potentiating activity) (EPA) (Fibroblast collagenase inhibitor) (Collagenase inhibitor) (Tissue inhibitor of metalloproteinases 1) (TIMP-1)

Protein function

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8,

PDB

1D2B , 1OO9 , 1UEA , 2J0T , 3MA2 , 3V96 , 6MAV , 6N9D , 7S7L , 7S7M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00965	TIMP	22 → 199	Tissue inhibitor of metalloproteinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in rheumatoid synovial fluid (at protein level). {ECO:0000269|PubMed:1730286}.

Sequence

MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQR
YEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHIT
TCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEK
GFQSRHLACLPREPGLCTWQSLRSQIA

Sequence length

207

Interactions

View interactions

	KEGG		Reactome
	HIF-1 signaling pathway		Platelet degranulation Activation of Matrix Metalloproteinases Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Interleukin-10 signaling Interleukin-4 and Interleukin-13 signaling Post-translational protein phosphorylation

TIMP1 (TIMP metallopeptidase inhibitor 1)