Gene Gene information from NCBI Gene database.
Entrez ID 7071
Gene name KLF transcription factor 10
Gene symbol KLF10
Synonyms (NCBI Gene)
EGR-alphaEGRATIEGTIEG1
Chromosome 8
Chromosome location 8q22.3
Summary This gene encodes a member of a family of proteins that feature C2H2-type zinc finger domains. The encoded protein is a transcriptional repressor that acts as an effector of transforming growth factor beta signaling. Activity of this protein may inhibit t
miRNA miRNA information provided by mirtarbase database.
627
miRTarBase ID miRNA Experiments Reference
MIRT004212 hsa-miR-197-3p Microarray 16822819
MIRT019621 hsa-miR-340-5p Sequencing 20371350
MIRT023455 hsa-miR-30b-5p Sequencing 20371350
MIRT024713 hsa-miR-215-5p Microarray 19074876
MIRT026652 hsa-miR-192-5p Microarray 19074876
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
VHL Unknown 18359287
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 9748269
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 15087465
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601878 11810 ENSG00000155090
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13118
Protein name Krueppel-like factor 10 (EGR-alpha) (Transforming growth factor-beta-inducible early growth response protein 1) (TGFB-inducible early growth response protein 1) (TIEG-1)
Protein function Transcriptional repressor which binds to the consensus sequence 5'-GGTGTG-3'. Plays a role in the regulation of the circadian clock; binds to the GC box sequence in the promoter of the core clock component ARTNL/BMAL1 and represses its transcrip
PDB 2EPA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 399 423 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 429 451 Zinc finger, C2H2 type Domain
Sequence
MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYV
ENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFK
SLSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNY
QNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSVPSSETVI
CRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPA
VCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQ
IDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHR
RTH
TGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ
Sequence length 480
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
8
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs980112 RCV005919928
Cholangiocarcinoma Benign rs980112 RCV005919930
KLF10-related disorder Uncertain significance; Likely benign; Benign rs141560064, rs377740938, rs143947106, rs778787697, rs1587834203 RCV003958456
RCV003892954
RCV003923577
RCV003399705
RCV003911877
Ovarian serous cystadenocarcinoma Benign rs980112 RCV005919929
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
alpha 1 Antitrypsin Deficiency Stimulate 22621770
Arthritis Rheumatoid Associate 34713769
Breast Neoplasms Associate 12841681
Breast Neoplasms Inhibit 31640084
Carcinoma Hepatocellular Associate 22563190
Carcinoma Renal Cell Associate 18359287
Carcinoma Squamous Cell Associate 37746966
Cardiomyopathy Hypertrophic Associate 22234868
Diabetes Mellitus Associate 35730406
Diabetes Mellitus Type 2 Stimulate 35730406