Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7071
Gene name Gene Name - the full gene name approved by the HGNC.
KLF transcription factor 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLF10
Synonyms (NCBI Gene) Gene synonyms aliases
EGR-alpha, EGRA, TIEG, TIEG1
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q22.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a family of proteins that feature C2H2-type zinc finger domains. The encoded protein is a transcriptional repressor that acts as an effector of transforming growth factor beta signaling. Activity of this protein may inhibit t
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004212 hsa-miR-197-3p Microarray 16822819
MIRT019621 hsa-miR-340-5p Sequencing 20371350
MIRT023455 hsa-miR-30b-5p Sequencing 20371350
MIRT024713 hsa-miR-215-5p Microarray 19074876
MIRT026652 hsa-miR-192-5p Microarray 19074876
Transcription factors
Transcription factor Regulation Reference
VHL Unknown 18359287
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 9748269
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 15087465
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601878 11810 ENSG00000155090
Protein
UniProt ID Q13118
Protein name Krueppel-like factor 10 (EGR-alpha) (Transforming growth factor-beta-inducible early growth response protein 1) (TGFB-inducible early growth response protein 1) (TIEG-1)
Protein function Transcriptional repressor which binds to the consensus sequence 5'-GGTGTG-3'. Plays a role in the regulation of the circadian clock; binds to the GC box sequence in the promoter of the core clock component ARTNL/BMAL1 and represses its transcrip
PDB 2EPA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 399 423 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 429 451 Zinc finger, C2H2 type Domain
Sequence
MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYV
ENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFK
SLSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNY
QNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSVPSSETVI
CRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPA
VCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQ
IDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHR
RTH
TGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ
Sequence length 480
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Gout Gout N/A N/A GWAS
Hypertrophic cardiomyopathy hypertrophic cardiomyopathy N/A N/A GenCC
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
alpha 1 Antitrypsin Deficiency Stimulate 22621770
Arthritis Rheumatoid Associate 34713769
Breast Neoplasms Associate 12841681
Breast Neoplasms Inhibit 31640084
Carcinoma Hepatocellular Associate 22563190
Carcinoma Renal Cell Associate 18359287
Carcinoma Squamous Cell Associate 37746966
Cardiomyopathy Hypertrophic Associate 22234868
Diabetes Mellitus Associate 35730406
Diabetes Mellitus Type 2 Stimulate 35730406