THBS3 (thrombospondin 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 7059
Gene name Thrombospondin 3
Gene symbol THBS3
Synonyms (NCBI Gene)
TSP3
Chromosome 1
Chromosome location 1q22
Summary The protein encoded by this gene belongs to the thrombospondin family. Thrombospondin family members are adhesive glycoproteins that mediate cell-to-cell and cell-to-matrix interactions. This protein forms a pentameric molecule linked by a single disulfid
miRNA miRNA information provided by mirtarbase database.
7
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (7)
miRTarBase ID miRNA Experiments Reference
MIRT017421 hsa-miR-335-5p Microarray 18185580
MIRT2126813 hsa-miR-1182 CLIP-seq
MIRT2126814 hsa-miR-2392 CLIP-seq
MIRT2126815 hsa-miR-3925-3p CLIP-seq
MIRT2126816 hsa-miR-665 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (16)
GO ID Ontology Definition Evidence Reference
GO:0003417 Process Growth plate cartilage development IEA
GO:0005201 Function Extracellular matrix structural constituent RCA 28327460
GO:0005509 Function Calcium ion binding IEA
GO:0005509 Function Calcium ion binding NAS 7558000
GO:0005515 Function Protein binding IPI 32814053
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
188062 11787 ENSG00000169231
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P49746
Protein name Thrombospondin-3
Protein function Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Can bind to fibrinogen, fibronectin, laminin and type V collagen.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11598 COMP 226 → 270 Cartilage oligomeric matrix protein Family
PF07645 EGF_CA 316 → 357 Calcium-binding EGF domain Domain
PF07645 EGF_CA 370 → 412 Calcium-binding EGF domain Domain
PF02412 TSP_3 492 → 527 Thrombospondin type 3 repeat Repeat
PF02412 TSP_3 551 → 586 Thrombospondin type 3 repeat Repeat
PF02412 TSP_3 586 → 609 Thrombospondin type 3 repeat Repeat
PF02412 TSP_3 610 → 647 Thrombospondin type 3 repeat Repeat
PF02412 TSP_3 648 → 687 Thrombospondin type 3 repeat Repeat
PF02412 TSP_3 688 → 723 Thrombospondin type 3 repeat Repeat
PF05735 TSP_C 741 → 938 Thrombospondin C-terminal region Family
Sequence 
METQELRGALALLLLCFFTSASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHS
PAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
Sequence length 956
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cytoskeleton in muscle cells
Malaria
Human papillomavirus infection 		  Signaling by PDGF
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Prostate cancer Uncertain significance rs193920931 RCV000149192
Show/Hide Text Mining Associations (14)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Aortic Aneurysm Abdominal Associate 34669362
Attention Deficit Disorder with Hyperactivity Associate 31235756
Carcinoma Renal Cell Associate 34983129
Carcinoma Renal Cell Stimulate 36045611
COVID 19 Associate 33961290, 39344392
Immunologic Deficiency Syndromes Associate 19116307
Metabolic Syndrome Associate 34638981
Mood Disorders Associate 31235756
Myocardial Infarction Inhibit 36336864
Neoplasm Metastasis Stimulate 17022822