THBS3 (thrombospondin 3)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7059
Gene name Gene Name - the full gene name approved by the HGNC.
Thrombospondin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
THBS3
Synonyms (NCBI Gene) Gene synonyms aliases
TSP3
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q22
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the thrombospondin family. Thrombospondin family members are adhesive glycoproteins that mediate cell-to-cell and cell-to-matrix interactions. This protein forms a pentameric molecule linked by a single disulfid
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(7)
miRTarBase ID miRNA Experiments Reference
MIRT017421 hsa-miR-335-5p Microarray 18185580
MIRT2126813 hsa-miR-1182 CLIP-seq
MIRT2126814 hsa-miR-2392 CLIP-seq
MIRT2126815 hsa-miR-3925-3p CLIP-seq
MIRT2126816 hsa-miR-665 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0003417 Process Growth plate cartilage development IEA
GO:0005201 Function Extracellular matrix structural constituent RCA 28327460
GO:0005509 Function Calcium ion binding NAS 7558000
GO:0005515 Function Protein binding IPI 32814053
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
188062 11787 ENSG00000169231
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P49746
Protein name Thrombospondin-3
Protein function Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Can bind to fibrinogen, fibronectin, laminin and type V collagen.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11598 COMP 226 → 270 Cartilage oligomeric matrix protein Family
PF07645 EGF_CA 316 → 357 Calcium-binding EGF domain Domain
PF07645 EGF_CA 370 → 412 Calcium-binding EGF domain Domain
PF02412 TSP_3 492 → 527 Thrombospondin type 3 repeat Repeat
PF02412 TSP_3 551 → 586 Thrombospondin type 3 repeat Repeat
PF02412 TSP_3 586 → 609 Thrombospondin type 3 repeat Repeat
PF02412 TSP_3 610 → 647 Thrombospondin type 3 repeat Repeat
PF02412 TSP_3 648 → 687 Thrombospondin type 3 repeat Repeat
PF02412 TSP_3 688 → 723 Thrombospondin type 3 repeat Repeat
PF05735 TSP_C 741 → 938 Thrombospondin C-terminal region Family
Sequence 
METQELRGALALLLLCFFTSASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHS
PAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
Sequence length 956
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cytoskeleton in muscle cells
Malaria
Human papillomavirus infection 		  Signaling by PDGF
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Gout Gout GWAS
Hypertension Hypertension GWAS
Carpal Tunnel Syndrome Carpal Tunnel Syndrome GWAS
Show/Hide Text Mining Associations (14)
Associations from Text Mining
Disease Name Relationship Type References
Aortic Aneurysm Abdominal Associate 34669362
Attention Deficit Disorder with Hyperactivity Associate 31235756
Carcinoma Renal Cell Associate 34983129
Carcinoma Renal Cell Stimulate 36045611
COVID 19 Associate 33961290, 39344392
Immunologic Deficiency Syndromes Associate 19116307
Metabolic Syndrome Associate 34638981
Mood Disorders Associate 31235756
Myocardial Infarction Inhibit 36336864
Neoplasm Metastasis Stimulate 17022822