Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7056
Gene name Gene Name - the full gene name approved by the HGNC.	Thrombomodulin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	THBD
Synonyms (NCBI Gene) Gene synonyms aliases	AHUS6, BDCA-3, BDCA3, CD141, THPH12, THRM, TM
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20p11.21
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this intronless gene is an endothelial-specific type I membrane receptor that binds thrombin. This binding results in the activation of protein C, which degrades clotting factors Va and VIIIa and reduces the amount of thrombin gener

Show/Hide all(10)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1800576	C>T	Conflicting-interpretations-of-pathogenicity, risk-factor, likely-benign	Missense variant, coding sequence variant
rs1800578	G>A,T	Risk-factor, likely-benign	Missense variant, coding sequence variant
rs1800579	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, coding sequence variant
rs16984852	C>A	Pathogenic	5 prime UTR variant
rs121918667	T>C	Risk-factor	Coding sequence variant, missense variant
rs398122807	C>A	Pathogenic	Coding sequence variant, missense variant
rs1347587434	G>A,T	Likely-pathogenic	Synonymous variant, stop gained, coding sequence variant
rs1600409143	G>T	Likely-pathogenic	Stop gained, coding sequence variant
rs1600409323	G>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1600410451	C>-	Likely-pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(174)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017044	hsa-miR-335-5p	Microarray	18185580
MIRT024294	hsa-miR-215-5p	Microarray	19074876
MIRT026159	hsa-miR-192-5p	Microarray	19074876
MIRT636182	hsa-miR-4436b-3p	HITS-CLIP	23824327
MIRT636181	hsa-miR-4632-5p	HITS-CLIP	23824327
MIRT636180	hsa-miR-6735-5p	HITS-CLIP	23824327
MIRT636178	hsa-miR-6879-5p	HITS-CLIP	23824327
MIRT636179	hsa-miR-7843-5p	HITS-CLIP	23824327
MIRT636177	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT636176	hsa-miR-3127-5p	HITS-CLIP	23824327
MIRT639318	hsa-miR-578	HITS-CLIP	23824327
MIRT636182	hsa-miR-4436b-3p	HITS-CLIP	23824327
MIRT636181	hsa-miR-4632-5p	HITS-CLIP	23824327
MIRT636180	hsa-miR-6735-5p	HITS-CLIP	23824327
MIRT636178	hsa-miR-6879-5p	HITS-CLIP	23824327
MIRT636179	hsa-miR-7843-5p	HITS-CLIP	23824327
MIRT639322	hsa-miR-6132	HITS-CLIP	23824327
MIRT639321	hsa-miR-6836-5p	HITS-CLIP	23824327
MIRT636177	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT639320	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT639319	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT636176	hsa-miR-3127-5p	HITS-CLIP	23824327
MIRT639318	hsa-miR-578	HITS-CLIP	23824327
MIRT636182	hsa-miR-4436b-3p	HITS-CLIP	23824327
MIRT636181	hsa-miR-4632-5p	HITS-CLIP	23824327
MIRT636180	hsa-miR-6735-5p	HITS-CLIP	23824327
MIRT636178	hsa-miR-6879-5p	HITS-CLIP	23824327
MIRT636179	hsa-miR-7843-5p	HITS-CLIP	23824327
MIRT636177	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT636176	hsa-miR-3127-5p	HITS-CLIP	23824327
MIRT636182	hsa-miR-4436b-3p	HITS-CLIP	23824327
MIRT636181	hsa-miR-4632-5p	HITS-CLIP	23824327
MIRT636180	hsa-miR-6735-5p	HITS-CLIP	23824327
MIRT636178	hsa-miR-6879-5p	HITS-CLIP	23824327
MIRT636179	hsa-miR-7843-5p	HITS-CLIP	23824327
MIRT636177	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT636176	hsa-miR-3127-5p	HITS-CLIP	23824327
MIRT639318	hsa-miR-578	HITS-CLIP	23824327
MIRT636182	hsa-miR-4436b-3p	HITS-CLIP	23824327
MIRT636181	hsa-miR-4632-5p	HITS-CLIP	23824327
MIRT636180	hsa-miR-6735-5p	HITS-CLIP	23824327
MIRT636178	hsa-miR-6879-5p	HITS-CLIP	23824327
MIRT636179	hsa-miR-7843-5p	HITS-CLIP	23824327
MIRT639322	hsa-miR-6132	HITS-CLIP	23824327
MIRT639321	hsa-miR-6836-5p	HITS-CLIP	23824327
MIRT636177	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT639320	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT639319	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT636176	hsa-miR-3127-5p	HITS-CLIP	23824327
MIRT639318	hsa-miR-578	HITS-CLIP	23824327
MIRT636182	hsa-miR-4436b-3p	HITS-CLIP	23824327
MIRT636181	hsa-miR-4632-5p	HITS-CLIP	23824327
MIRT636180	hsa-miR-6735-5p	HITS-CLIP	23824327
MIRT636178	hsa-miR-6879-5p	HITS-CLIP	23824327
MIRT636179	hsa-miR-7843-5p	HITS-CLIP	23824327
MIRT636177	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT636176	hsa-miR-3127-5p	HITS-CLIP	23824327
MIRT1422762	hsa-miR-1182	CLIP-seq
MIRT1422763	hsa-miR-1193	CLIP-seq
MIRT1422764	hsa-miR-1202	CLIP-seq
MIRT1422765	hsa-miR-1208	CLIP-seq
MIRT1422766	hsa-miR-1243	CLIP-seq
MIRT1422767	hsa-miR-1275	CLIP-seq
MIRT1422768	hsa-miR-1298	CLIP-seq
MIRT1422769	hsa-miR-1323	CLIP-seq
MIRT1422770	hsa-miR-18a	CLIP-seq
MIRT1422771	hsa-miR-18b	CLIP-seq
MIRT1422772	hsa-miR-193a-5p	CLIP-seq
MIRT1422773	hsa-miR-19a	CLIP-seq
MIRT1422774	hsa-miR-19b	CLIP-seq
MIRT1422775	hsa-miR-2053	CLIP-seq
MIRT1422776	hsa-miR-21	CLIP-seq
MIRT1422777	hsa-miR-3065-5p	CLIP-seq
MIRT1422778	hsa-miR-3120-3p	CLIP-seq
MIRT1422779	hsa-miR-3155	CLIP-seq
MIRT1422780	hsa-miR-3155b	CLIP-seq
MIRT1422781	hsa-miR-3167	CLIP-seq
MIRT1422782	hsa-miR-3194-5p	CLIP-seq
MIRT1422783	hsa-miR-320a	CLIP-seq
MIRT1422784	hsa-miR-320b	CLIP-seq
MIRT1422785	hsa-miR-320c	CLIP-seq
MIRT1422786	hsa-miR-320d	CLIP-seq
MIRT1422787	hsa-miR-320e	CLIP-seq
MIRT1422788	hsa-miR-342-5p	CLIP-seq
MIRT1422789	hsa-miR-3545-3p	CLIP-seq
MIRT1422790	hsa-miR-365	CLIP-seq
MIRT1422791	hsa-miR-3653	CLIP-seq
MIRT1422792	hsa-miR-3654	CLIP-seq
MIRT1422793	hsa-miR-3681	CLIP-seq
MIRT1422794	hsa-miR-384	CLIP-seq
MIRT1422795	hsa-miR-3925-3p	CLIP-seq
MIRT1422796	hsa-miR-3972	CLIP-seq
MIRT1422797	hsa-miR-4267	CLIP-seq
MIRT1422798	hsa-miR-4275	CLIP-seq
MIRT1422799	hsa-miR-4284	CLIP-seq
MIRT1422800	hsa-miR-4317	CLIP-seq
MIRT1422801	hsa-miR-4429	CLIP-seq
MIRT1422802	hsa-miR-4466	CLIP-seq
MIRT1422803	hsa-miR-452	CLIP-seq
MIRT1422804	hsa-miR-4651	CLIP-seq
MIRT1422805	hsa-miR-4659a-5p	CLIP-seq
MIRT1422806	hsa-miR-4659b-5p	CLIP-seq
MIRT1422807	hsa-miR-4664-5p	CLIP-seq
MIRT1422808	hsa-miR-4665-5p	CLIP-seq
MIRT1422809	hsa-miR-4676-3p	CLIP-seq
MIRT1422810	hsa-miR-4699-5p	CLIP-seq
MIRT1422811	hsa-miR-4706	CLIP-seq
MIRT1422812	hsa-miR-4711-3p	CLIP-seq
MIRT1422813	hsa-miR-4728-5p	CLIP-seq
MIRT1422814	hsa-miR-4731-5p	CLIP-seq
MIRT1422815	hsa-miR-4735-3p	CLIP-seq
MIRT1422816	hsa-miR-4749-5p	CLIP-seq
MIRT1422817	hsa-miR-4766-3p	CLIP-seq
MIRT1422818	hsa-miR-4776-3p	CLIP-seq
MIRT1422819	hsa-miR-4796-3p	CLIP-seq
MIRT1422820	hsa-miR-484	CLIP-seq
MIRT1422821	hsa-miR-515-5p	CLIP-seq
MIRT1422822	hsa-miR-518a-5p	CLIP-seq
MIRT1422823	hsa-miR-520d-5p	CLIP-seq
MIRT1422824	hsa-miR-520g	CLIP-seq
MIRT1422825	hsa-miR-520h	CLIP-seq
MIRT1422826	hsa-miR-524-5p	CLIP-seq
MIRT1422827	hsa-miR-527	CLIP-seq
MIRT1422828	hsa-miR-548o	CLIP-seq
MIRT1422829	hsa-miR-548p	CLIP-seq
MIRT1422830	hsa-miR-552	CLIP-seq
MIRT1422831	hsa-miR-590-5p	CLIP-seq
MIRT1422832	hsa-miR-608	CLIP-seq
MIRT1422833	hsa-miR-622	CLIP-seq
MIRT1422834	hsa-miR-637	CLIP-seq
MIRT1422835	hsa-miR-675	CLIP-seq
MIRT1422836	hsa-miR-744	CLIP-seq
MIRT1422837	hsa-miR-766	CLIP-seq
MIRT1422838	hsa-miR-876-5p	CLIP-seq
MIRT1422839	hsa-miR-9	CLIP-seq
MIRT1422840	hsa-miR-942	CLIP-seq
MIRT1422800	hsa-miR-4317	CLIP-seq
MIRT1422805	hsa-miR-4659a-5p	CLIP-seq
MIRT1422806	hsa-miR-4659b-5p	CLIP-seq
MIRT1920970	hsa-miR-4670-3p	CLIP-seq
MIRT1920971	hsa-miR-4731-3p	CLIP-seq
MIRT1422818	hsa-miR-4776-3p	CLIP-seq
MIRT1920972	hsa-miR-4801	CLIP-seq
MIRT1422800	hsa-miR-4317	CLIP-seq
MIRT1422805	hsa-miR-4659a-5p	CLIP-seq
MIRT1422806	hsa-miR-4659b-5p	CLIP-seq
MIRT1920970	hsa-miR-4670-3p	CLIP-seq
MIRT1920971	hsa-miR-4731-3p	CLIP-seq
MIRT1422818	hsa-miR-4776-3p	CLIP-seq
MIRT1920972	hsa-miR-4801	CLIP-seq
MIRT1920970	hsa-miR-4670-3p	CLIP-seq
MIRT1920971	hsa-miR-4731-3p	CLIP-seq
MIRT1920972	hsa-miR-4801	CLIP-seq
MIRT1422762	hsa-miR-1182	CLIP-seq
MIRT1422790	hsa-miR-365	CLIP-seq
MIRT1422813	hsa-miR-4728-5p	CLIP-seq
MIRT1422821	hsa-miR-515-5p	CLIP-seq
MIRT2348622	hsa-miR-3166	CLIP-seq
MIRT2348623	hsa-miR-3609	CLIP-seq
MIRT2348624	hsa-miR-4468	CLIP-seq
MIRT1422821	hsa-miR-515-5p	CLIP-seq
MIRT2348625	hsa-miR-548ah	CLIP-seq
MIRT2348626	hsa-miR-548t	CLIP-seq
MIRT1422840	hsa-miR-942	CLIP-seq
MIRT2395783	hsa-miR-4661-3p	CLIP-seq
MIRT2395784	hsa-miR-665	CLIP-seq
MIRT1422769	hsa-miR-1323	CLIP-seq
MIRT2641740	hsa-miR-4299	CLIP-seq
MIRT2641741	hsa-miR-4456	CLIP-seq
MIRT2641742	hsa-miR-4762-5p	CLIP-seq
MIRT1422817	hsa-miR-4766-3p	CLIP-seq
MIRT1422828	hsa-miR-548o	CLIP-seq
MIRT1422829	hsa-miR-548p	CLIP-seq
MIRT2641743	hsa-miR-548q	CLIP-seq

Transcription factors

Show/Hide all(14)

Transcription factor	Regulation	Reference
EP300	Repression	15677570
KLF2	Activation	19661484
KLF4	Activation	19661484
NFKB1	Repression	17211835;22406829
PARP1	Activation	21489980
PARP1	Repression	21489980
RARA	Activation	9269772
RARA	Unknown	11036068
RARB	Unknown	11036068
RARG	Unknown	11036068
RELA	Repression	17211835;22406829
RXRA	Unknown	11036068
SP1	Activation	22406829
SP1	Unknown	11036068

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	10336638
GO:0005515	Function	Protein binding	IPI	14691232, 17379830, 32296183
GO:0005615	Component	Extracellular space	IEA
GO:0005774	Component	Vacuolar membrane	IEA
GO:0005886	Component	Plasma membrane	IDA	17379830
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2822087
GO:0006508	Process	Proteolysis	NAS	12524220
GO:0007565	Process	Female pregnancy	IEA
GO:0007596	Process	Blood coagulation	IEA
GO:0007596	Process	Blood coagulation	TAS	9252393
GO:0007599	Process	Hemostasis	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	17379830
GO:0009986	Component	Cell surface	IEA
GO:0010165	Process	Response to X-ray	IEA
GO:0010544	Process	Negative regulation of platelet activation	TAS	17379830
GO:0016020	Component	Membrane	IEA
GO:0016327	Component	Apicolateral plasma membrane	IEA
GO:0030195	Process	Negative regulation of blood coagulation	IDA	10761923
GO:0030195	Process	Negative regulation of blood coagulation	IDA	10761923
GO:0030195	Process	Negative regulation of blood coagulation	NAS	12524220
GO:0030195	Process	Negative regulation of blood coagulation	TAS	15005336
GO:0030195	Process	Negative regulation of blood coagulation	TAS	17379830
GO:0031638	Process	Zymogen activation	NAS	12524220
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0038023	Function	Signaling receptor activity	IDA	10761923
GO:0038023	Function	Signaling receptor activity	TAS	2822087
GO:0050819	Process	Negative regulation of coagulation	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0051918	Process	Negative regulation of fibrinolysis	TAS	17379830
GO:0072377	Process	Blood coagulation, common pathway	NAS	12524220
GO:1905370	Component	Serine-type endopeptidase complex	IPI	14691232

MIM	HGNC	e!Ensembl
188040	11784	ENSG00000178726

Protein

UniProt ID

P07204

Protein name

Thrombomodulin (TM) (Fetomodulin) (CD antigen CD141)

Protein function

Endothelial cell receptor that plays a critical role in regulating several physiological processes including hemostasis, coagulation, fibrinolysis, inflammation, and angiogenesis (PubMed:10761923). Acts as a cofactor for thrombin activation of p

PDB

1ADX , 1DQB , 1DX5 , 1EGT , 1FGD , 1FGE , 1HLT , 1TMR , 1ZAQ , 2ADX , 3GIS , 5TO3 , 7T4R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	41 → 169	Lectin C-type domain	Domain
PF14670	FXa_inhibition	245 → 280		Domain
PF12662	cEGF	305 → 328	Complement Clr-like EGF-like	Domain

Tissue specificity

TISSUE SPECIFICITY: Endothelial cells are unique in synthesizing thrombomodulin.

Sequence

MLGVLVLGALALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLM
TVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYS
RWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAV
EPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAP
GAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNP
DQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDG
ECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPN
TQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSALARHIGTDC
DSGKVDGGDSGSGEPPPSPTPGSTLTPPAVGLVHSGLLIGISIASLCLVVALLALLCHLR
KKQGAARAKMEYKCAAPSKEVVLQHVRTERTPQRL

Sequence length

575

Interactions

View interactions

	KEGG		Reactome
	Complement and coagulation cascades AGE-RAGE signaling pathway in diabetic complications Fluid shear stress and atherosclerosis		Common Pathway of Fibrin Clot Formation Cell surface interactions at the vascular wall

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Hemolytic Uremic Syndrome	Atypical hemolytic-uremic syndrome with thrombomodulin anomaly	rs1600410451	N/A
Thrombomodulin-related bleeding disorder	thrombomodulin-related bleeding disorder	rs2122673257	N/A

Show/Hide Text Mining Associations (185)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abortion Habitual	Associate	29195508
Abortion Spontaneous	Inhibit	20051099
Abortion Spontaneous	Associate	29195508
Acute Kidney Injury	Associate	34190147
Adenocarcinoma	Associate	12194995, 1357974, 33762601
Airway Remodeling	Associate	16390543
Anemia Sickle Cell	Associate	22052675
Angina Stable	Associate	18035074
Aortic Aneurysm Abdominal	Associate	25993293
Arterial Occlusive Diseases	Associate	10627464
Arthritis	Associate	34691053
Arthritis Infectious	Associate	32849606
Arthritis Juvenile	Associate	32849606
Arthritis Rheumatoid	Associate	1660324, 29867920, 37298499
Atherosclerosis	Inhibit	11549570
Atherosclerosis	Associate	1316788, 15009462, 16126727, 17895503, 27910925, 35855629
Atrial Fibrillation	Inhibit	29364003
Atypical Hemolytic Uremic Syndrome	Associate	22410797, 35619721, 36755127
Autoimmune Diseases of the Nervous System	Associate	31014550
Behcet Syndrome	Associate	36226612
Blood Coagulation Disorders	Associate	11084048, 21489300, 25049278, 25564403, 27436851, 27793368, 27910925, 28406995, 30764845, 31793409, 32634856, 33683204, 35033854, 37753073
Blood Coagulation Disorders	Inhibit	15591227
Buruli Ulcer	Associate	26181660
Carcinogenesis	Associate	20345486
Carcinoma Hepatocellular	Associate	11570577
Carcinoma Intraductal Noninfiltrating	Associate	11953822
Carcinoma Non Small Cell Lung	Associate	28121350
Carcinoma Ovarian Epithelial	Associate	23918310
Carcinoma Squamous Cell	Associate	17965528, 21623236, 7717460, 8163684
Carcinoma Squamous Cell	Stimulate	29851300
Cardiovascular Diseases	Associate	15869594, 17677000, 34236150, 35075098, 35854198
Cerebral Infarction	Associate	15574195, 30383853, 39631512
Chronic Kidney Disease Mineral and Bone Disorder	Associate	28784837
Churg Strauss Syndrome	Associate	17437420
Classical Lissencephalies and Subcortical Band Heterotopias	Associate	23341914
Cognition Disorders	Inhibit	39631512
Cognitive Dysfunction	Stimulate	27553758
Colitis Ulcerative	Associate	23388545
Colorectal Neoplasms	Associate	16622452, 23209692, 27512995, 32531444
Complement Factor H Deficiency	Associate	29592796, 35619721
Congenital Hemidysplasia with Ichthyosiform Erythroderma and Limb Defects	Associate	36646026
Corneal Endothelial Cell Loss	Associate	21871056
Coronary Artery Disease	Associate	11549570
Coronary Disease	Associate	35075098
Coronary Thrombosis	Associate	11549570
COVID 19	Inhibit	33683204, 35033854
COVID 19	Associate	35064759, 36696180
Critical Illness	Associate	33141764
Crohn Disease	Associate	22802339
Crohn Disease	Inhibit	23950992
Cushing's symphalangism	Associate	12135317
Death	Stimulate	33015987
Diabetes Gestational	Associate	31061324
Diabetes Mellitus	Associate	15869594, 17895503, 22734102
Diabetes Mellitus	Stimulate	21871056
Diabetic Angiopathies	Associate	9326350
Disseminated Intravascular Coagulation	Associate	10331507, 21489300, 29257196, 29851300, 3025256
Drug Hypersensitivity	Associate	21988460
Drug Related Side Effects and Adverse Reactions	Stimulate	28121350
Embolic Stroke	Associate	15574195
Endometrial Neoplasms	Associate	40332167
Familial Primary Pulmonary Hypertension	Associate	16390543
Farber Lipogranulomatosis	Associate	27436851, 32634856
Fetal Growth Retardation	Associate	34693872
Fibrosis	Associate	24049150, 29577605, 38309434
Fuchs' Endothelial Dystrophy	Associate	36773096
Genetic Diseases Inborn	Associate	25564403
Glut1 Deficiency Syndrome	Associate	27553758
Graft vs Host Disease	Associate	22689672, 31300420
Hand Arm Vibration Syndrome	Associate	38302542
Heart Diseases	Associate	30008974
Helicobacter Infections	Stimulate	20345486
Hemolytic Uremic Syndrome	Associate	10331507, 19625716
Hemophilia A	Associate	23889493
Hemorrhage	Associate	25564403, 27436851, 31793409, 32634856, 34628704
Hepatic Veno Occlusive Disease	Associate	21330458
Hepatitis B Chronic	Associate	36646026
Hepatitis C	Stimulate	22711645
Homocystinuria	Associate	1661291
Hypertension	Associate	22734102
Hypertension Pulmonary	Associate	10666169
Hypertriglyceridemia	Associate	17895503
Hypothermia	Inhibit	37369465
Hypoxia	Associate	30518680
Hypoxia	Inhibit	35033854
Immunologic Deficiency Syndromes	Associate	35064759
Infections	Inhibit	2169619
Inflammation	Inhibit	11549570, 16622452, 20116378, 31273091, 39631512
Inflammation	Associate	15574195, 15869594, 16126727, 18334611, 20051099, 21489300, 21781252, 21871056, 23881386, 25039491, 27793368, 30518680, 36226612
Intestinal Diseases	Associate	20345486
Intracranial Thrombosis	Associate	23741007
Kidney Diseases	Inhibit	33069430
Kidney Failure Chronic	Associate	21873362
Leprosy	Associate	27706378
Leukemia	Inhibit	22327096
Leukemia	Associate	31273091, 7949172, 9269772
Leukemia Lymphocytic Chronic B Cell	Stimulate	21812019
Leukemia Myeloid Acute	Inhibit	22327096
Leukemia Myeloid Acute	Associate	23616009, 8555488
Leukemia Promyelocytic Acute	Inhibit	22327096
Leukemia Promyelocytic Acute	Associate	7949172
Lung Neoplasms	Associate	28121350, 29851300, 32655564
Lupus Erythematosus Systemic	Associate	13130472
Lupus Erythematosus Systemic	Inhibit	16178860
Lymphatic Metastasis	Associate	17391312
Macular Degeneration	Associate	29592796
Malaria	Associate	28732053
Malaria Cerebral	Associate	23741007
Malaria Falciparum	Associate	28732053
Melanoma	Associate	15900300, 33737341
Melanoma	Inhibit	24366193
Meningococcal Infections	Inhibit	11496851
Mesothelioma	Associate	11570906, 12194995, 16056246, 16554731
Mesothelioma Malignant	Associate	12194995, 1357974, 21489980
Mucocutaneous Lymph Node Syndrome	Associate	30008974
Multiple Organ Failure	Associate	10331507
Multiple Organ Failure	Inhibit	33069430
Multiple Sclerosis	Associate	31857644
Myelodysplastic Syndromes	Associate	31273091
Myocardial Infarction	Associate	10627464, 12135317, 18035074, 22734102
Myocardial Ischemia	Associate	15574195
Myocardial Ischemia	Stimulate	15869594
Nasal Polyps	Associate	25469646
Neonatal herpes	Inhibit	2169619
Neoplasm Invasiveness	Stimulate	11953822
Neoplasm Invasiveness	Associate	19238079
Neoplasm Metastasis	Associate	17406026
Neoplasm Metastasis	Stimulate	33015987
Neoplasms	Associate	12548614, 17695537, 17895503, 19182372, 21489980, 23881386, 27512995, 32655564, 35320906, 38237862, 39793535, 7507301
Neoplasms	Stimulate	23388545, 33713666
Neoplasms	Inhibit	24366193, 28121350, 31531696
Neoplasms Cystic Mucinous and Serous	Associate	16056246
Neoplastic Syndromes Hereditary	Associate	25049278, 34474479
Neurofibroma Plexiform	Associate	16390543
Nevus Pigmented	Associate	24366193
Ovarian Neoplasms	Associate	32590296, 33571724
Pagetoid Reticulosis	Associate	30711015
Pancreatic Neoplasms	Associate	36272973, 8198971
Placenta Diseases	Associate	34693872
Plaque Atherosclerotic	Inhibit	17869327
Porencephaly	Associate	25049278
Pre Eclampsia	Associate	17895503, 27793368, 34693872
Precancerous Conditions	Associate	32531444
Prostatic Neoplasms	Associate	24633886, 32590296
Protein C Deficiency	Associate	19133979
Proteus Syndrome	Associate	31490637
Pulmonary Atelectasis	Associate	38373411
Pulmonary Disease Chronic Obstructive	Stimulate	25775429
Pulmonary Embolism	Associate	33103541, 7811989
Purpura	Associate	26181660
Purpura Thrombotic Thrombocytopenic	Associate	10331507
Renal Artery Obstruction	Associate	38031731
Renal Insufficiency	Associate	25135762
Renal Insufficiency	Inhibit	33069430
Renal Insufficiency Chronic	Associate	24049150, 35854198
Renal Insufficiency Chronic	Inhibit	33069430
Respiratory Distress Syndrome	Associate	25643902, 27215212, 28732053, 32931480
Sarcoma Kaposi	Associate	7507301
Scleroderma Diffuse	Associate	12905480, 8985465
Scleroderma Systemic	Associate	10666169, 12905480
Sepsis	Associate	3025256, 34190147
Simpson Golabi Behmel syndrome	Associate	31490637
Squamous Cell Carcinoma of Head and Neck	Associate	10609562
Stomach Neoplasms	Associate	20345486
Stroke	Associate	15574195, 17895503, 31271700
Thrombocythemia Essential	Associate	17577920
Thromboembolism	Associate	7811989
Thromboinflammation	Associate	37902278
Thrombomodulin anomalies familial	Associate	31793409
Thrombophilia	Associate	23332921, 29577605, 32634856, 38309434
Thrombosis	Associate	11549570, 11570577, 15574195, 16126727, 1661291, 17677000, 19133979, 21781252, 23332921, 23881386, 26181660, 29257196, 32384541, 34970867, 34981912, 35033854, 36226612 View all (2 more)
Thrombosis	Inhibit	20116378, 29364003, 34693872
Thrombosis	Stimulate	21873362
Tomaculous neuropathy	Associate	31793409, 34628704
Tonsillar Neoplasms	Associate	29795118
Urethral Neoplasms	Associate	30711015
Urinary Bladder Neoplasms	Associate	33238953
Usher Syndrome Type IE	Associate	23741007
Uterine Cervical Neoplasms	Associate	23881386
Vascular Diseases	Associate	11110700, 32382091, 9326350
Vascular System Injuries	Associate	12871544
Venous Thromboembolism	Associate	12871544, 15842356, 27081095, 28049360, 32781781, 33725974, 34970867
Venous Thromboembolism	Inhibit	26888256
Venous Thrombosis	Associate	23332921, 28049360, 34142473, 34236150
Wounds and Injuries	Associate	8163684

THBD (thrombomodulin)