Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7040
Gene name	Transforming growth factor beta 1
Gene symbol	TGFB1
Synonyms (NCBI Gene)	CEDDPD1IBDIMDELAPTGF-beta1TGFBTGFbeta
Chromosome	19
Chromosome location	19q13.2
Summary	This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate

Show/Hide all (17)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1800470	G>A,C	Risk-factor, benign	Coding sequence variant, missense variant
rs72480429	G>A,C	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs104894719	A>G	Pathogenic	Coding sequence variant, missense variant
rs104894720	C>T	Pathogenic	Coding sequence variant, missense variant
rs104894721	G>A	Pathogenic	Coding sequence variant, missense variant
rs104894722	A>C,G,T	Pathogenic	Coding sequence variant, missense variant
rs111033611	A>G	Pathogenic	Coding sequence variant, missense variant
rs200164212	C>T	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs200482214	G>A	Pathogenic	Missense variant, coding sequence variant
rs281865483	->AGCAGCAGC	Pathogenic	Coding sequence variant, inframe insertion
rs281865484	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs281865485	G>C	Pathogenic	Missense variant, coding sequence variant
rs1057521741	G>C	Likely-pathogenic	Coding sequence variant, stop gained
rs1336387628	A>C,G,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs1555755242	G>A	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1555755308	G>A	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1599893542	T>C	Likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all (71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005918	hsa-miR-24-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	20945401
MIRT006059	hsa-miR-29b-3p	ELISAGFP reporter assayqRT-PCR	21273536
MIRT006114	hsa-miR-144-3p	Luciferase reporter assayqRT-PCR	21991303
MIRT006059	hsa-miR-29b-3p	ELISAGFP reporter assayqRT-PCR	21273536
MIRT006114	hsa-miR-144-3p	Luciferase reporter assayqRT-PCR	21991303
MIRT006499	hsa-miR-633	Luciferase reporter assay	20637737
MIRT006499	hsa-miR-633	Luciferase reporter assay	20637737
MIRT006059	hsa-miR-29b-3p	ELISAGFP reporter assayqRT-PCR	21273536
MIRT006114	hsa-miR-144-3p	Luciferase reporter assayqRT-PCR	21991303
MIRT006499	hsa-miR-633	Luciferase reporter assay	20637737
MIRT006791	hsa-miR-663a	Luciferase reporter assayWestern blot	22393947
MIRT030730	hsa-miR-21-5p	Microarray	18591254
MIRT030730	hsa-miR-21-5p	Microarray	18591254
MIRT037719	hsa-miR-744-5p	CLASH	23622248
MIRT053337	hsa-miR-211-5p	Luciferase reporter assayqRT-PCRWestern blot	23726841
MIRT437865	hsa-miR-17-5p	qRT-PCR	23433743
MIRT437866	hsa-miR-19b-3p	qRT-PCR	23433743
MIRT438749	hsa-miR-130a-3p	ELISALuciferase reporter assayqRT-PCR	24801815
MIRT438206	hsa-miR-122-5p	qRT-PCR	24168656
MIRT438040	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438039	hsa-miR-93-5p	qRT-PCR	24367666
MIRT438749	hsa-miR-130a-3p	ELISALuciferase reporter assayqRT-PCR	24801815
MIRT438206	hsa-miR-122-5p	qRT-PCR	24168656
MIRT438040	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438039	hsa-miR-93-5p	qRT-PCR	24367666
MIRT006791	hsa-miR-663a	Luciferase reporter assayqRT-PCRWestern blot	27624777
MIRT006791	hsa-miR-663a	Luciferase reporter assayqRT-PCRWestern blot	27624777
MIRT652731	hsa-miR-422a	Luciferase reporter assayqRT-PCRWestern blot	27779704
MIRT731900	hsa-miR-422a	Luciferase reporter assayqRT-PCRWestern blot	27779704
MIRT006059	hsa-miR-29b-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27895107
MIRT756323	hsa-miR-29b-1-5p	qRT-PCRWestern blot	27273381
MIRT030730	hsa-miR-21-5p	ELISAqRT-PCR	26383248
MIRT053337	hsa-miR-211-5p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCR	32720595
MIRT733548	hsa-miR-486-3p	ImmunofluorescenceImmunoprecipitaion (IP)Luciferase reporter assayqRT-PCRWestern blotting	34080770
MIRT733724	hsa-miR-30d-3p	MicroarrayWestern blotting	33917330
MIRT733725	hsa-miR-106a-3p	MicroarrayWestern blotting	33917330
MIRT006114	hsa-miR-144-3p	MicroarrayWestern blotting	33917330
MIRT733781	hsa-miR-542-3p	ELISAWestern blotting	33785768
MIRT733781	hsa-miR-542-3p	ELISAWestern blotting	33785768
MIRT733867	hsa-miR-425-5p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	33073700
MIRT734383	hsa-miR-26b-5p	qRT-PCRELISA	34185228
MIRT037719	hsa-miR-744-5p	Flow cytometryImmunofluorescenceIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blotting	31643031
MIRT734616	hsa-miR-7641	Immunohistochemistry (IHC)ImmunofluorescenceqRT-PCR	32823722
MIRT736384	hsa-miR-494-3p	qRT-PCR	33247701
MIRT736453	hsa-miR-1343-3p	Western blottingRNA-seqqRT-PCR	33194007
MIRT737523	hsa-miR-21-3p	qRT-PCRELISA	33804922
MIRT737545	hsa-miR-1468-3p	Luciferase reporter assayWestern blottingRNA-seqFlow cytometry	32348937
MIRT737550	hsa-miR-133a-3p	Luciferase reporter assayWestern blottingRNA-seqImmunofluorescenceqRT-PCR	31511493
MIRT737566	hsa-miR-182-3p	Western blottingqRT-PCR	32067333
MIRT737574	hsa-miR-744-3p	Luciferase reporter assayImmunofluorescenceqRT-PCRIn situ hybridizationFlow cytometry	31643031
MIRT006791	hsa-miR-663a	Western blottingqRT-PCR	31572558
MIRT037719	hsa-miR-744-5p	Luciferase reporter assayWestern blottingqRT-PCR	35593122
MIRT006791	hsa-miR-663a	Western blottingqRT-PCR	35832307
MIRT734383	hsa-miR-26b-5p	qRT-PCR	34185228
MIRT756323	hsa-miR-29b-1-5p	Western blotting	38934067
MIRT1421108	hsa-miR-1908	CLIP-seq
MIRT1421109	hsa-miR-3180	CLIP-seq
MIRT1421110	hsa-miR-3180-3p	CLIP-seq
MIRT1421111	hsa-miR-3196	CLIP-seq
MIRT1421112	hsa-miR-3714	CLIP-seq
MIRT1421113	hsa-miR-3943	CLIP-seq
MIRT1421114	hsa-miR-4488	CLIP-seq
MIRT1421115	hsa-miR-4651	CLIP-seq
MIRT1421116	hsa-miR-4697-5p	CLIP-seq
MIRT1421117	hsa-miR-4708-3p	CLIP-seq
MIRT1421118	hsa-miR-4781-5p	CLIP-seq
MIRT1421119	hsa-miR-564	CLIP-seq
MIRT1421120	hsa-miR-608	CLIP-seq
MIRT1421121	hsa-miR-663	CLIP-seq
MIRT1421122	hsa-miR-744	CLIP-seq
MIRT1421123	hsa-miR-885-3p	CLIP-seq

Show/Hide all (14)

Transcription factor	Regulation	Reference
ASH1L	Unknown	22488473
FOSB	Unknown	10843986
FOSL2	Unknown	10843986
JUND	Unknown	10843986
NFKB1	Unknown	16365456
SMAD3	Repression	19214138
SMAD4	Unknown	21968601
SMAD7	Activation	19214138
SP1	Activation	9580699
SP1	Unknown	22415074;2808430
STAT3	Activation	16474852
USF1	Activation	14757763
USF2	Activation	14757763
USF2	Unknown	15184388

327

Show/Hide all (327)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0001570	Process	Vasculogenesis	ISS
GO:0001657	Process	Ureteric bud development	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001763	Process	Morphogenesis of a branching structure	IEA
GO:0001775	Process	Cell activation	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	28373289
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	29529050
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	25893292
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	TAS	26451614
GO:0001843	Process	Neural tube closure	IEA
GO:0001843	Process	Neural tube closure	ISS
GO:0002028	Process	Regulation of sodium ion transport	IEA
GO:0002040	Process	Sprouting angiogenesis	IMP	31368162
GO:0002062	Process	Chondrocyte differentiation	IDA	15040835
GO:0002069	Process	Columnar/cuboidal epithelial cell maturation	IEA
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IDA	15451575
GO:0002248	Process	Connective tissue replacement involved in inflammatory response wound healing	TAS	9639571
GO:0002460	Process	Adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains	IEA
GO:0002513	Process	Tolerance induction to self antigen	IEA
GO:0002859	Process	Negative regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IDA	24586048
GO:0003179	Process	Heart valve morphogenesis	IEA
GO:0003179	Process	Heart valve morphogenesis	ISS
GO:0003180	Process	Aortic valve morphogenesis	IEA
GO:0003180	Process	Aortic valve morphogenesis	IMP	26634652
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IDA	11157754
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IEA
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IMP	8167376
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IPI	1333888
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	26572508, 32644293
GO:0005125	Function	Cytokine activity	TAS	24263861
GO:0005160	Function	Transforming growth factor beta receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	1326540, 2022183, 2119582, 7852346, 8370410, 8617200, 10092230, 10746731, 10885742, 10930463, 11157754, 15247411, 15864306, 17827158, 18672106, 19651619, 20505824, 20599762, 20856203, 20860622, 21054789, 21441952, 21677751, 25241761, 25416956, 25548275, 27339457, 28514442, 29909984
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IC	32644293
GO:0005615	Component	Extracellular space	IDA	19734317
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IDA	18040277
GO:0005737	Component	Cytoplasm	IDA	18040277
GO:0005737	Component	Cytoplasm	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0005902	Component	Microvillus	IDA	19366691
GO:0006611	Process	Protein export from nucleus	IDA	17438144
GO:0006754	Process	ATP biosynthetic process	IDA	10513816
GO:0006796	Process	Phosphate-containing compound metabolic process	IDA	10513816
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006915	Process	Apoptotic process	IMP	3470709
GO:0006954	Process	Inflammatory response	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	12015308, 18548003
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	9389648, 11157754, 12574355, 15334054, 18453574, 18593713, 18625725, 19736306, 26572508, 27693460, 28373289, 28467929, 31023188, 32644293
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IGI	22714950
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	25196641, 26908446, 31368162
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	ISS
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007406	Process	Negative regulation of neuroblast proliferation	IEA
GO:0007435	Process	Salivary gland morphogenesis	IEA
GO:0007435	Process	Salivary gland morphogenesis	IEP	18080134
GO:0007492	Process	Endoderm development	IEA
GO:0007507	Process	Heart development	IBA
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	ISS
GO:0007565	Process	Female pregnancy	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	IMP	31368162
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10513816, 14633705
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	26169693
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	14555988, 15334054
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	11158066
GO:0008354	Process	Germ cell migration	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009611	Process	Response to wounding	IEP	18040277
GO:0009749	Process	Response to glucose	IEA
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	IMP	19366691
GO:0010467	Process	Gene expression	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	TAS	19506300
GO:0010628	Process	Positive regulation of gene expression	IDA	18625725, 18832382, 18941241, 19913496, 25322725, 26634652, 26687115, 27162619, 28467929, 29167509, 31694982
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IGI	22269326
GO:0010628	Process	Positive regulation of gene expression	IMP	26169693
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010628	Process	Positive regulation of gene expression	NAS	26451614
GO:0010629	Process	Negative regulation of gene expression	IDA	29529050
GO:0010629	Process	Negative regulation of gene expression	IDA	19913496, 20067797, 22269326, 25163461, 26634652, 28467929, 29167509
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IGI	22269326
GO:0010629	Process	Negative regulation of gene expression	IGI	22269326
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	NAS	26451614
GO:0010716	Process	Negative regulation of extracellular matrix disassembly	TAS	22269326
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	17999987, 18505915, 26572508
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	21490602
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	NAS	21319131
GO:0010742	Process	Macrophage derived foam cell differentiation	IC	15219857
GO:0010763	Process	Positive regulation of fibroblast migration	IDA	18555217
GO:0010763	Process	Positive regulation of fibroblast migration	IEA
GO:0010936	Process	Negative regulation of macrophage cytokine production	IDA	20875417
GO:0010936	Process	Negative regulation of macrophage cytokine production	IEA
GO:0014003	Process	Oligodendrocyte development	IEA
GO:0014008	Process	Positive regulation of microglia differentiation	IEA
GO:0014008	Process	Positive regulation of microglia differentiation	ISS
GO:0016202	Process	Regulation of striated muscle tissue development	IEA
GO:0016202	Process	Regulation of striated muscle tissue development	ISS
GO:0019899	Function	Enzyme binding	IPI	19366691
GO:0021915	Process	Neural tube development	IEA
GO:0021915	Process	Neural tube development	ISS
GO:0030141	Component	Secretory granule	IEA
GO:0030214	Process	Hyaluronan catabolic process	IDA	17324121
GO:0030217	Process	T cell differentiation	IEA
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030308	Process	Negative regulation of cell growth	IDA	15334054
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030334	Process	Regulation of cell migration	TAS	19018011
GO:0030335	Process	Positive regulation of cell migration	IDA	19736306
GO:0030335	Process	Positive regulation of cell migration	IMP	26169693
GO:0030424	Component	Axon	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0031012	Component	Extracellular matrix	HDA	23979707
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	ISS
GO:0031093	Component	Platelet alpha granule lumen	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031100	Process	Animal organ regeneration	IEA
GO:0031293	Process	Membrane protein intracellular domain proteolysis	IDA	25310401
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	19366691
GO:0031536	Process	Positive regulation of exit from mitosis	IEA
GO:0032355	Process	Response to estradiol	IDA	18039789
GO:0032355	Process	Response to estradiol	IEA
GO:0032570	Process	Response to progesterone	IDA	18039789
GO:0032570	Process	Response to progesterone	IEA
GO:0032667	Process	Regulation of interleukin-23 production	IEA
GO:0032700	Process	Negative regulation of interleukin-17 production	IEA
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	18453574
GO:0032740	Process	Positive regulation of interleukin-17 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	25196641
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	32141990
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	32141990
GO:0032801	Process	Receptor catabolic process	IDA	17878231
GO:0032930	Process	Positive regulation of superoxide anion generation	IDA	22073128
GO:0032943	Process	Mononuclear cell proliferation	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IDA	19734317, 22269326, 25310401
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IEA
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IGI	22269326
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IMP	11158066
GO:0033280	Process	Response to vitamin D	IEA
GO:0034616	Process	Response to laminar fluid shear stress	IEA
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IMP	8167376
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IPI	10885742
GO:0034714	Function	Type III transforming growth factor beta receptor binding	IEA
GO:0034714	Function	Type III transforming growth factor beta receptor binding	IMP	8167376
GO:0034714	Function	Type III transforming growth factor beta receptor binding	IPI	10092230
GO:0035800	Function	Deubiquitinase activator activity	IDA	32644293
GO:0035902	Process	Response to immobilization stress	IEA
GO:0036446	Process	Myofibroblast differentiation	NAS	28095798
GO:0042098	Process	T cell proliferation	IEA
GO:0042110	Process	T cell activation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0042306	Process	Regulation of protein import into nucleus	IEA
GO:0042306	Process	Regulation of protein import into nucleus	ISS
GO:0042307	Process	Positive regulation of protein import into nucleus	IDA	19366691
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0042482	Process	Positive regulation of odontogenesis	IEA
GO:0042552	Process	Myelination	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	21677751
GO:0043025	Component	Neuronal cell body	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043117	Process	Positive regulation of vascular permeability	IDA	21168935
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	25196641
GO:0043129	Process	Surfactant homeostasis	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	29203640
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	26572508
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	18555217
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	18555217
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	32644293
GO:0043539	Function	Protein serine/threonine kinase activator activity	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045066	Process	Regulatory T cell differentiation	IDA	32644293
GO:0045066	Process	Regulatory T cell differentiation	IDA	32644293
GO:0045066	Process	Regulatory T cell differentiation	IEA
GO:0045216	Process	Cell-cell junction organization	IDA	18505915
GO:0045216	Process	Cell-cell junction organization	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045589	Process	Regulation of regulatory T cell differentiation	IEA
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IEP	19357233
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IDA	15040835
GO:0045662	Process	Negative regulation of myoblast differentiation	IDA	9770491
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IDA	18625725
GO:0045786	Process	Negative regulation of cell cycle	IDA	11502704
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15702480, 18832382
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9389648, 14517293, 15334054
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12676957, 17884155
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12574355, 18832382, 22073128
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046716	Process	Muscle cell cellular homeostasis	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048286	Process	Lung alveolus development	IEA
GO:0048298	Process	Positive regulation of isotype switching to IgA isotypes	IDA	14988498
GO:0048535	Process	Lymph node development	IEA
GO:0048535	Process	Lymph node development	ISS
GO:0048565	Process	Digestive tract development	IEA
GO:0048642	Process	Negative regulation of skeletal muscle tissue development	IDA	9770491
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	28467929, 31023188
GO:0048839	Process	Inner ear development	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IDA	9950587
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IMP	16943770
GO:0050714	Process	Positive regulation of protein secretion	IDA	18505915
GO:0050714	Process	Positive regulation of protein secretion	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IMP	32141990
GO:0050765	Process	Negative regulation of phagocytosis	IEA
GO:0050832	Process	Defense response to fungus	IEA
GO:0050868	Process	Negative regulation of T cell activation	IEA
GO:0050921	Process	Positive regulation of chemotaxis	IDA	18555217
GO:0051130	Process	Positive regulation of cellular component organization	IEA
GO:0051152	Process	Positive regulation of smooth muscle cell differentiation	IEA
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	IDA	15219857
GO:0051280	Process	Negative regulation of release of sequestered calcium ion into cytosol	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	18625725
GO:0055010	Process	Ventricular cardiac muscle tissue morphogenesis	IEA
GO:0055010	Process	Ventricular cardiac muscle tissue morphogenesis	ISS
GO:0055091	Process	Phospholipid homeostasis	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060312	Process	Regulation of blood vessel remodeling	NAS	22269326
GO:0060312	Process	Regulation of blood vessel remodeling	TAS	22269326
GO:0060325	Process	Face morphogenesis	IEA
GO:0060364	Process	Frontal suture morphogenesis	IEA
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IDA	9389648, 17438144, 17999987, 18453574, 19366691, 19736306, 25196641, 25893292, 26634652, 27693460, 28467929, 29167509, 31023188
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IEA
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IGI	22714950
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IMP	26908446
GO:0060435	Process	Bronchiole development	IEA
GO:0060744	Process	Mammary gland branching involved in thelarche	IEA
GO:0060751	Process	Branch elongation involved in mammary gland duct branching	IEA
GO:0060762	Process	Regulation of branching involved in mammary gland duct morphogenesis	IEA
GO:0061035	Process	Regulation of cartilage development	IEA
GO:0061298	Process	Retina vasculature development in camera-type eye	IEA
GO:0061448	Process	Connective tissue development	IEA
GO:0061520	Process	Langerhans cell differentiation	IEA
GO:0070168	Process	Negative regulation of biomineral tissue development	IDA	26634652
GO:0070168	Process	Negative regulation of biomineral tissue development	IEA
GO:0070173	Process	Regulation of enamel mineralization	IEA
GO:0070306	Process	Lens fiber cell differentiation	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	25310401
GO:0070723	Process	Response to cholesterol	IDA	17878231
GO:0071260	Process	Cellular response to mechanical stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	IMP	32141990
GO:0071456	Process	Cellular response to hypoxia	IMP	31368162
GO:0071479	Process	Cellular response to ionizing radiation	IEA
GO:0071479	Process	Cellular response to ionizing radiation	IEA
GO:0071549	Process	Cellular response to dexamethasone stimulus	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IDA	19736306, 22269326
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IGI	22269326
GO:0071677	Process	Positive regulation of mononuclear cell migration	IEA
GO:0071895	Process	Odontoblast differentiation	IEA
GO:0071895	Process	Odontoblast differentiation	ISS
GO:0072089	Process	Stem cell proliferation	IEA
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0085029	Process	Extracellular matrix assembly	IDA	19734317
GO:0085029	Process	Extracellular matrix assembly	IEA
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	12893825, 15040835
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	25605017
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	15334054, 26572508
GO:0097421	Process	Liver regeneration	IEA
GO:0098586	Process	Cellular response to virus	IEA
GO:0141091	Process	Transforming growth factor beta receptor superfamily signaling pathway	IEA
GO:1900126	Process	Negative regulation of hyaluronan biosynthetic process	IDA	17324121
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	26634652
GO:1900182	Process	Positive regulation of protein localization to nucleus	IEA
GO:1901203	Process	Positive regulation of extracellular matrix assembly	IEA
GO:1901203	Process	Positive regulation of extracellular matrix assembly	ISS	24279830
GO:1901203	Process	Positive regulation of extracellular matrix assembly	NAS	27098600, 28095798
GO:1901203	Process	Positive regulation of extracellular matrix assembly	TAS	22269326
GO:1902074	Process	Response to salt	IEA
GO:1902462	Process	Positive regulation of mesenchymal stem cell proliferation	IGI	22714950
GO:1902893	Process	Regulation of miRNA transcription	IMP	18548003
GO:1902894	Process	Negative regulation of miRNA transcription	IMP	25605017
GO:1902894	Process	Negative regulation of miRNA transcription	NAS	26451614
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	26311719, 26493107
GO:1903077	Process	Negative regulation of protein localization to plasma membrane	IDA	21168935, 24586048
GO:1904018	Process	Positive regulation of vasculature development	IDA	27693460
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IDA	28467929
GO:1905005	Process	Regulation of epithelial to mesenchymal transition involved in endocardial cushion formation	ISS
GO:1905641	Process	Cellular response to acetaldehyde	IEA
GO:1990314	Process	Cellular response to insulin-like growth factor stimulus	IEA
GO:1990402	Process	Embryonic liver development	IEA
GO:1990402	Process	Embryonic liver development	ISS
GO:2000048	Process	Negative regulation of cell-cell adhesion mediated by cadherin	IDA	18593713
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IMP	32141990
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IMP	32141990
GO:2000636	Process	Positive regulation of primary miRNA processing	IDA	18548003
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA
GO:2000727	Process	Positive regulation of cardiac muscle cell differentiation	IDA	25163461

MIM	HGNC	e!Ensembl
190180	11766	ENSG00000105329

P01137

Protein name

Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide (LAP); Transforming growth factor beta-1 (TGF-beta-1)]

Protein function

Transforming growth factor beta-1 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains, which constitute the regulatory and active subunit of TGF-beta-1, respectively. {ECO:00002

PDB

1KLA , 1KLC , 1KLD , 3KFD , 4KV5 , 5FFO , 5VQP , 6OM2 , 6P7J , 7Y1R , 7Y1T , 8UDZ , 8VSC , 8VSD , 9FDY , 9FKP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00688	TGFb_propeptide	29 → 261	TGF-beta propeptide	Family
PF00019	TGF_beta	292 → 389	Transforming growth factor beta like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in bone (PubMed:11746498, PubMed:17827158). Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA) (PubMed:11746498, PubMed:17827158). Colocalizes with ASPN in chondrocytes

Sequence

MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Sequence length

390

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Cytokine-cytokine receptor interaction FoxO signaling pathway Cell cycle Efferocytosis Cellular senescence TGF-beta signaling pathway Osteoclast differentiation Hippo signaling pathway Th17 cell differentiation Intestinal immune network for IgA production Relaxin signaling pathway Non-alcoholic fatty liver disease AGE-RAGE signaling pathway in diabetic complications Leishmaniasis Chagas disease Malaria Toxoplasmosis Amoebiasis Tuberculosis Hepatitis B Human T-cell leukemia virus 1 infection Pathways in cancer Proteoglycans in cancer Colorectal cancer Renal cell carcinoma Pancreatic cancer Chronic myeloid leukemia Hepatocellular carcinoma Gastric cancer Inflammatory bowel disease Rheumatoid arthritis Hypertrophic cardiomyopathy Dilated cardiomyopathy Diabetic cardiomyopathy		Platelet degranulation Influenza Virus Induced Apoptosis Cell surface interactions at the vascular wall Molecules associated with elastic fibres Downregulation of TGF-beta receptor signaling TGF-beta receptor signaling activates SMADs TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition) Syndecan interactions SMAD2/3 Phosphorylation Motif Mutants in Cancer TGFBR2 MSI Frameshift Mutants in Cancer TGFBR2 Kinase Domain Mutants in Cancer TGFBR1 KD Mutants in Cancer TGFBR1 LBD Mutants in Cancer Interleukin-4 and Interleukin-13 signaling RUNX3 regulates CDKN1A transcription Regulation of RUNX3 expression and activity RUNX3 regulates p14-ARF

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
CAMURATI-ENGELMANN DISEASE 1	Likely pathogenic; Pathogenic	rs104894720	RCV005867746
Diaphyseal dysplasia	Pathogenic; Likely pathogenic	rs104894719, rs104894720, rs104894721, rs111033611, rs104894722, rs1599893542	RCV000013354 RCV000013355 RCV000013357 RCV000013358 RCV000013359 RCV000990219
Encephalopathy	Likely pathogenic	rs1555755308, rs1555755242, rs1336387628	RCV000584758 RCV000584755 RCV000584756
IL10-related early-onset inflammatory bowel disease	Likely pathogenic	rs1555755308, rs1555755242, rs1336387628	RCV000584758 RCV000584755 RCV000584756
Inflammatory bowel disease, immunodeficiency, and encephalopathy	Likely pathogenic	rs2513384226, rs1555755308, rs1555755242, rs1336387628	RCV004547204 RCV000723358 RCV000723357 RCV000723356
See cases	Pathogenic	rs104894721	RCV003156058

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs6508976, rs11466318	RCV005921503 RCV005909237
Breast cancer, invasive, susceptibility to	Benign	rs1800470	RCV000013361
Cervical cancer	Benign	rs11466318	RCV005909238
Cystic fibrosis	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign	rs867906741, rs1800470, rs148552731, rs765327656, rs8179181, rs11466318	RCV002503603 RCV005016986 RCV005016751 RCV005017126 RCV002479963 RCV000013360 RCV003224536
Gastric cancer	Benign	rs11466318	RCV005909240
Meckel syndrome, type 10	Benign	rs1800470	RCV002496341
Sarcoma	Benign	rs11466318	RCV005909239
TGFB1-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign	rs201430293, rs148552731, rs147873920, rs202071274, rs201948484, rs200482214, rs199699574, rs190566789	RCV003402055 RCV003395262 RCV003933517 RCV003946436 RCV003406248 RCV003426281 RCV003947948 RCV003938205
Uterine carcinosarcoma	Benign	rs11466318	RCV005909241
Uterine corpus endometrial carcinoma	Benign	rs11466318	RCV005909242

Show/Hide Text Mining Associations (1371)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
3 methylcrotonyl CoA carboxylase 1 deficiency	Associate	37207705
AA amyloidosis	Associate	32861330
Abortion Threatened	Associate	32775426
Accidental Injuries	Associate	16367920
Achondrogenesis type 2	Stimulate	32790806
Achondrogenesis type 2	Associate	39367925
Acidemia isovaleric	Associate	25510775
Acidosis	Associate	23318822
Acidosis	Inhibit	36012235
Acne Vulgaris	Associate	24927181, 25153527
Acquired Immunodeficiency Syndrome	Stimulate	1708784, 8264131
Acquired Immunodeficiency Syndrome	Associate	2007861, 8149667
Acro Osteolysis	Associate	21099351, 33207819
Acrocephalosyndactylia	Inhibit	24385687
Acrogeria gottron type	Associate	9061041
Acromelic frontonasal dysplasia	Associate	25979247
Acromicric dysplasia	Associate	18677313, 21683322
Acute Coronary Syndrome	Associate	24558424, 24737521, 25612606, 34239024, 35109843
Acute Coronary Syndrome	Inhibit	25740578
Acute Disease	Associate	18344931
Acute erythroleukemia	Associate	31888734
Acute Kidney Injury	Associate	15086490, 25147823, 34795878
Acute On Chronic Liver Failure	Stimulate	25716231
Adenocarcinoma	Associate	11004479, 15192088, 16368780, 16428382, 16884377, 17264880, 18281501, 21305538, 23705641, 25113249, 26447543, 27540973, 28898237, 32764738, 33807408, 34247571, 36434043, 36938549, 8318404 View all (4 more)
Adenocarcinoma	Stimulate	34009501
Adenocarcinoma in Situ	Associate	23705641
Adenocarcinoma Mucinous	Associate	18422752, 27982025, 31060539
Adenocarcinoma of Lung	Associate	17653092, 20506050, 21523732, 22300324, 24928833, 25060702, 25816405, 25928368, 25944163, 27748883, 30014971, 30609689, 31432173, 32603557, 32643848 View all (12 more)
Adenocarcinoma Scirrhous	Associate	7577468, 8142266
Adenoma	Associate	23108401, 24472434, 26510091, 27100181, 27221051, 30412224, 9250163
Adenoma Pleomorphic	Associate	20379686, 34884420
Adenomatous Polyposis Coli	Stimulate	18422752
Adenomatous Polyposis Coli	Associate	24472434, 34360002
Adenomyosis	Associate	29253010, 37884924
Adrenal Hyperplasia Congenital	Associate	24380766
Adrenocortical Carcinoma	Associate	23866946
Aggressive Periodontitis	Inhibit	32074214
AIDS Associated Nephropathy	Stimulate	9987082
AIDS Dementia Complex	Associate	11282546
AIDS Dementia Complex	Stimulate	16496359
Airway Obstruction	Associate	19811381, 34915763
Airway Remodeling	Associate	23682108, 24828686, 27126693
Albuminuria	Associate	18293167, 33080601
Alcoholism	Associate	19794996
Alcoholism	Stimulate	22623064, 35371104
Allanson Pantzar McLeod syndrome	Associate	22140272
Allergic Fungal Sinusitis	Associate	16916603, 23663486, 24115141, 26047816, 30161164, 31664133, 33000196, 34445093
Alopecia	Associate	12894997, 16755026, 27472703, 36982775
Alopecia Areata	Stimulate	8721483
Alopecia Neurologic Defects and Endocrinopathy Syndrome	Associate	37854185
Alzheimer Disease	Associate	12000710, 15834029, 17889927, 21368376, 24731980, 28557134, 32309439, 34705667
Alzheimer Disease	Stimulate	21741294
Alzheimer Disease	Inhibit	8879214
Ameloblastoma	Associate	32879156
Amyloid Neuropathies Familial	Associate	35627273
Amyloidosis Cerebroarterial App Related	Associate	28557134
Amyloidosis Cerebroarterial App Related	Stimulate	28557134
Amyotrophic Lateral Sclerosis	Associate	25634178, 31107959, 34767750
Anal Gland Neoplasms	Associate	24074435
Androgen Insensitivity Syndrome	Stimulate	11300459
Androgen Insensitivity Syndrome	Associate	25313366
Anemia	Associate	38022547
Anemia Aplastic	Inhibit	10606887
Anemia Aplastic	Associate	26214243, 27933374, 32590737
Anemia Diamond Blackfan	Associate	26258650
Anemia Hemolytic Autoimmune	Associate	30784322
Anemia Sickle Cell	Associate	18187665, 24391023, 26508723, 27026283, 33062074
Aneuploidy	Associate	27926867
Aneurysm	Associate	12787696, 19672284, 22955109, 23291965, 24768363, 27720318, 28679693, 29165337, 31147528, 34185228, 35909487, 37864304
Aneurysm Ascending Aorta	Associate	25465469
Angina Stable	Inhibit	10475771
Angina Unstable	Stimulate	10475771
Angina Unstable	Associate	24533640
Angiofibroma	Associate	32218621
Anodontia	Associate	15086490, 21126344
Anophthalmia with pulmonary hypoplasia	Associate	22761868, 24670043, 26586478
Anterior Wall Myocardial Infarction	Associate	26930482
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Stimulate	8697616
Aortic Aneurysm	Associate	19299629, 20067609, 23099432, 23291965, 25465469, 29174139, 30006123, 35052435
Aortic Aneurysm	Stimulate	31147528
Aortic Aneurysm Abdominal	Associate	12787696, 23538006, 24768363, 26027897
Aortic Aneurysm Familial Abdominal 1	Associate	26925780
Aortic Aneurysm Thoracic	Associate	19672284, 20829218, 21448509, 23099432, 24707114, 25835445, 26017485, 27146836, 27298013, 27394642, 37445606, 37894814
Aortic Aneurysm Thoracoabdominal	Stimulate	10709066
Aortic Diseases	Associate	19744994
Aortic Dissection	Stimulate	12787696, 24720641
Aortic Dissection	Associate	25113270, 25835445, 27146836, 27632686, 28679693, 35307021, 35971448, 37226099, 40139558
Aortic Root Aneurysm	Stimulate	22479353
Aortic Root Aneurysm	Associate	28679693, 31886938, 32404006
Aortic Valve Stenosis	Associate	35181609
Apical Hypertrophic Cardiomyopathy	Inhibit	31520610
Arrhythmias Cardiac	Associate	27380173
Arrhythmogenic Right Ventricular Dysplasia	Associate	20124997
Arterial Tortuosity Syndrome	Associate	24193348, 26376865
Arteriosclerosis	Inhibit	21862019
Arteriovenous Fistula	Associate	11849456, 12911563
Arteriovenous Malformations	Associate	35393474, 36198763
Arteritis	Associate	22955109
Arthritis	Associate	10088774, 26518873, 30320351
Arthritis	Stimulate	1914237
Arthritis Gouty	Associate	39259129
Arthritis Infectious	Associate	7722463
Arthritis Juvenile	Associate	21740541, 23121667, 24782191
Arthritis Psoriatic	Associate	1908092, 36672844
Arthritis Psoriatic	Stimulate	36997896
Arthritis Rheumatoid	Associate	10343777, 11966774, 12176809, 12384915, 15695537, 17200409, 1747946, 17594488, 18721452, 1908092, 19192274, 19279017, 19886735, 20380722, 20628268 View all (19 more)
Arthritis Rheumatoid	Stimulate	1914237, 28376277, 34301999
Arthritis Rheumatoid	Inhibit	26518873, 32543888, 36233253
Arthropathy progressive pseudorheumatoid of childhood	Associate	23947815
Ascites	Associate	30142697, 33921783
Asthma	Associate	10893219, 12370400, 14523040, 1575583, 16365456, 17202225, 17333284, 17369289, 17673695, 19043669, 19153535, 19539983, 19733294, 19857272, 19910030 View all (46 more)
Asthma	Stimulate	21170080, 21908588, 22206775, 22227561, 24067469, 25148800, 28284979, 30038057, 36834879
Asthma	Inhibit	26546895, 27221564
Asthma Aspirin Induced	Associate	16916603
Astrocytoma	Associate	23947815, 34162919
Atherosclerosis	Associate	10400038, 10749696, 11786115, 11849456, 12039487, 15800982, 16733295, 17591977, 21679448, 24495866, 24819318, 25119113, 25250731, 25720609, 25826292 View all (9 more)
Atherosclerosis	Inhibit	20954112, 27999237
Atherosclerosis	Stimulate	30942415
Atrial Fibrillation	Associate	20235205, 20356380, 24144036, 24349426, 25402477, 25422138, 26261573, 26774166, 28323847, 30153670, 30697920, 31173317, 33421993, 33681892, 34549527
Atrial Fibrillation	Stimulate	22412222, 24454806, 35348192
Atrial Remodeling	Associate	17635914, 25422138, 30697920
Atrioventricular Septal Defect	Associate	15358693
Atrophy	Associate	12641657, 14717921
Atypical Squamous Cells of the Cervix	Associate	29337896
Autism Spectrum Disorder	Associate	28344757
Autistic Disorder	Associate	23231720, 33839306, 34050248
Autoimmune Diseases	Associate	11309160, 12754205, 15800982, 16385528, 24799764, 28103949, 33837229, 36834770, 8697616
Autoimmune Diseases	Inhibit	12560464
Autoimmune Diseases	Stimulate	1575583
Autoimmune Diseases of the Nervous System	Stimulate	1575583
Axial Spondyloarthritis	Associate	30522483
Bacterial Infections	Associate	18292811
Baraitser Brett Piesowicz syndrome	Associate	32197075
Barlow syndrome	Associate	28417861
Barrett Esophagus	Associate	16368780, 19468668, 20080664, 21305538, 24714516, 26447543
Behcet Syndrome	Associate	18925687, 24984193, 31885007
Behcet Syndrome	Inhibit	35455984
Beta ketothiolase deficiency	Stimulate	9192977
Bicuspid Aortic Valve Disease	Associate	21448509, 27298013, 27394642, 29165337
Bile Duct Diseases	Associate	19878580
Biliary Atresia	Associate	26909983, 9708812
Biliary Tract Neoplasms	Associate	17470130
Birt Hogg Dube Syndrome	Inhibit	27905298
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	21726429
Bites Human	Associate	34943956
Blood Borne Infections	Associate	15542656
Blood Coagulation Disorders	Associate	26658659
Bone Cysts	Associate	32319543
Bone Diseases	Associate	10750555, 10780855, 11278244, 11590145, 11701443, 11918080, 12493741, 17900349, 18435575, 20308061, 21116815, 21740541, 22071418, 22629385, 25793716, 25808168, 39363898 View all (2 more)
Bone Diseases	Stimulate	23378237, 26667932
Bone Diseases Developmental	Associate	36339419
Bone Diseases Metabolic	Associate	10780855, 21124921, 25565391
Bone Marrow Diseases	Associate	19201832
Bone Marrow Failure Disorders	Associate	21189329, 31211692
Bone Neoplasms	Associate	12459458, 37993664
Bone Resorption	Associate	11701443, 25278075, 27279422, 36325441, 36482064
Bone Resorption	Inhibit	12933809
Brain Concussion	Associate	35412857
Brain Death	Stimulate	17430397
Brain Diseases	Associate	29483653, 30468562
Brain Injuries	Stimulate	26867675
Brain Ischemia	Associate	23511211
Brain Ischemia	Stimulate	23582094
Brain Neoplasms	Associate	12560464, 14669355, 23840623, 38256406, 39388865
Breast Cancer 3	Inhibit	25499443
Breast Diseases	Associate	32365829, 34261476
Breast Neoplasms	Associate	10993898, 11158583, 11444526, 11555647, 11590145, 11994274, 12163372, 12459458, 12461787, 12747808, 14739340, 15155736, 15520018, 15566434, 15878096 View all (249 more)
Breast Neoplasms	Stimulate	20562526, 26520789, 26976638, 27329104, 32543888, 36928924, 39180088
Breast Neoplasms	Inhibit	26919241, 28726720, 29713003, 3128508, 31766464, 9885238
Bronchiectasis	Associate	23776649, 27409985
Bronchiolitis	Stimulate	10885424
Bronchiolitis Obliterans	Associate	20497023
Bronchiolitis Obliterans Syndrome	Associate	16612332, 17378698, 19344464, 21641374, 25266000, 25649290, 32006713, 32250877, 9636965
Bronchiolitis Obliterans Syndrome	Stimulate	21629186, 26461171, 27994216
Bronchiolitis Viral	Associate	30562046
Bronchopulmonary Dysplasia	Associate	18756046, 24828686, 30001393, 33552042
Bruton type agammaglobulinemia	Associate	35382780
Burkitt Lymphoma	Associate	10846060, 10946276, 11062049, 11160743, 19022773, 19136942
Bursitis	Associate	27438566, 30667085, 36008780
Buschke Ollendorff syndrome	Associate	1629625
Cachexia	Stimulate	28288584
Cachexia	Associate	31273954
CADASIL	Associate	25190493
CADASIL	Stimulate	29536621
Calcinosis	Associate	18303197, 35808901
Calcinosis	Stimulate	36787443
Calcinosis Cutis	Associate	12174377, 20489157, 23988031, 24072492, 24310505, 25963361, 27067543, 28418896, 29138866, 30106153
Calcinosis Cutis	Stimulate	21826227
Camptodactyly fibrous tissue hyperplasia and skeletal dysplasia	Associate	25820556
Camurati Engelmann Syndrome	Associate	11278244, 12493741, 18591412, 19654961, 20308061, 21541994, 27959412, 28261436, 29620655, 30690794, 32668141, 34490910, 35315241, 36325441, 36339419, 39379987, 39596554, 40204055 View all (3 more)
Cancer Pain	Associate	18563556, 33522069
Candidiasis Chronic Mucocutaneous	Associate	31784499
Capillary Leak Syndrome	Associate	36494335
Capillary Malformation Arteriovenous Malformation	Associate	11073823
Capsule Opacification	Associate	27415760, 30332398, 32337261
Carcinogenesis	Associate	10333714, 10757810, 10777512, 10947082, 11253131, 11444526, 11555647, 12011061, 12237773, 12353499, 12747808, 1370826, 15155736, 16135802, 16368780 View all (82 more)
Carcinogenesis	Inhibit	11267935, 17875706, 26226105
Carcinogenesis	Stimulate	33168592
Carcinoid Heart Disease	Associate	8424467
Carcinoma	Associate	22641218
Carcinoma Adenoid Cystic	Associate	25485635, 29424489
Carcinoma Basal Cell	Associate	27117439
Carcinoma Ductal	Associate	16101174, 16627986, 38247878
Carcinoma Ductal Breast	Associate	30989460
Carcinoma Hepatocellular	Associate	10438468, 10490821, 10611320, 11257503, 12107103, 12593671, 15294900, 15509538, 15546505, 15777850, 16489684, 16617361, 17006932, 1703520, 18092051 View all (135 more)
Carcinoma Hepatocellular	Stimulate	11242803, 27268609
Carcinoma Hepatocellular	Inhibit	24960176, 28076850
Carcinoma Intraductal Noninfiltrating	Stimulate	18685848
Carcinoma Intraductal Noninfiltrating	Associate	31595577
Carcinoma Mucoepidermoid	Associate	37175975
Carcinoma Neuroendocrine	Associate	36653904
Carcinoma Non Small Cell Lung	Associate	10945495, 18687633, 19380441, 19690145, 20193119, 21249152, 21515830, 23059779, 23284751, 23334061, 23334091, 23705641, 23774211, 23840350, 24199791 View all (48 more)
Carcinoma Non Small Cell Lung	Inhibit	22107611, 25987100
Carcinoma Non Small Cell Lung	Stimulate	33125430, 36077264, 40682474
Carcinoma Ovarian Epithelial	Associate	10689548, 11531253, 21799915, 22138668, 24310505, 24452274, 24986540, 25307974, 26091707, 27118139, 28427435, 28623900, 29751820, 30485902
Carcinoma Ovarian Epithelial	Stimulate	21614520
Carcinoma Pancreatic Ductal	Associate	16101174, 17876328, 21624123, 21768661, 22869556, 23157946, 24378395, 24465802, 24500968, 25418581, 26284758, 26586478, 26588899, 27604902, 27895310 View all (24 more)
Carcinoma Pancreatic Ductal	Stimulate	22190968
Carcinoma Renal Cell	Associate	11171960, 12657102, 17279417, 19922630, 20208565, 21209004, 21826227, 24704995, 25381221, 25909813, 26713736, 27166254, 27619681, 27806310, 27812180 View all (19 more)
Carcinoma Renal Cell	Stimulate	24899691, 26848077, 31181623
Carcinoma Renal Cell	Inhibit	35350785
Carcinoma Signet Ring Cell	Associate	22569001
Carcinoma Skin Appendage	Associate	26261573
Carcinoma Small Cell	Associate	17469181
Carcinoma Squamous Cell	Associate	14970860, 15161003, 15247230, 15736400, 19383239, 19387481, 20179236, 21170261, 22002724, 22718118, 2478181, 25579378, 25813410, 27169370, 28102840 View all (16 more)
Carcinoma Transitional Cell	Associate	8439507
Carcinosarcoma	Associate	25918253, 37169340
Cardio Renal Syndrome	Associate	37707956
Cardiomyopathies	Associate	16584112, 26771187, 30115125, 33016206, 37526028
Cardiomyopathies	Stimulate	25298166
Cardiomyopathy Dilated	Stimulate	16095497, 21422001, 25298166
Cardiomyopathy Dilated	Associate	17635914, 26918958, 28399937, 33407844, 37268658, 37345811, 37840136
Cardiomyopathy Dilated	Inhibit	28207945
Cardiomyopathy Hypertrophic	Associate	11782760, 21920670, 25871499, 27569062, 31180540, 34192899, 34946964, 36252118
Cardiomyopathy Hypertrophic	Stimulate	24716596, 25973737, 31409892, 35406794
Cardiotoxicity	Associate	32013934, 33153480, 36204517
Cardiovascular Abnormalities	Associate	28679693
Cardiovascular Diseases	Associate	11786115, 15200451, 18821144, 21309044, 31520610, 32239175, 34807419, 37562580, 38256034, 40649979
Carotid Artery Diseases	Associate	24378993, 35937796
Carotid Stenosis	Associate	37121730
Carpal Tunnel Syndrome	Stimulate	24014274, 34224495
Carpal Tunnel Syndrome	Associate	25073432, 28120574, 30243295, 30927912, 32317146
Carrington syndrome	Associate	31012597
Cartilage Diseases	Associate	17827158, 22241609, 22883423, 24034904, 26395178, 29374435, 30677026, 32319543
Cartilage Diseases	Stimulate	30677026
Castleman Disease	Associate	34686774
Cataract	Associate	19001221, 22128246, 27415760, 37203095, 39959181
Cataract	Stimulate	35379202
Cataract Age Related Nuclear	Associate	31076560, 35379202
CD59 Deficiency	Associate	37257547
Celiac Disease	Associate	18064301, 28879170, 37047806
Celiac Disease	Stimulate	31115370
Celiac Disease	Inhibit	34449925
Cell Transformation Neoplastic	Associate	11444526, 20037158, 25786122, 26915435, 28484053, 29065973, 39180088, 9741623
Cell Transformation Neoplastic	Stimulate	20196115, 24648515
Central Nervous System Diseases	Associate	2007861, 29483653
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Associate	20054641
Cerebral Amyloid Angiopathy	Associate	15834029, 28557134
Cerebral Hemorrhage	Associate	33955515
Cerebral Infarction	Associate	21679448, 22769019
Cerebral Small Vessel Diseases	Associate	19788865, 32239807
Cerebrovascular Disorders	Associate	15200451, 21679448, 33050491, 33942489, 37459093
Chemical and Drug Induced Liver Injury	Associate	15800982, 19794996, 22806830, 23831117, 23991075, 24448807, 24496160, 24551192, 26097586, 26458849, 27227815, 27273381, 27990439, 28327812, 32054011 View all (5 more)
Chemical and Drug Induced Liver Injury	Stimulate	31148365
Chemical and Drug Induced Liver Injury Chronic	Associate	20196115
Chest Pain	Associate	35307021
Cholangiocarcinoma	Associate	15696189, 22068819, 24935374, 25526346, 25993985, 26077733, 26441331, 29084594, 29510695, 29569474, 29584696, 31976810, 34510808, 34548635, 35033156, 36443822, 37669935, 37789644 View all (3 more)
Cholangiocarcinoma	Stimulate	28873435, 36423790
Chondrocalcinosis	Associate	28377507
Chondrosarcoma	Associate	23088614, 23415961, 29044189
Chondrosarcoma Extraskeletal Myxoid	Associate	23441172, 35974707
Chordoma	Associate	36804377
Chorioamnionitis	Inhibit	18756046
Choroidal Effusions	Stimulate	18515987
Choroidal Effusions	Inhibit	26022333
Chronic Disease	Associate	12790768, 28804222, 29267209, 30109568
Chronic Periodontitis	Stimulate	25040058
Chronic Periodontitis	Associate	31351582
Chronic Urticaria	Associate	17237561
Churg Strauss Syndrome	Associate	8697616
Cicatrix	Stimulate	11231312
Cicatrix	Associate	32384749, 8245516
Cicatrix Hypertrophic	Associate	15800982, 21920670
Ciliary Motility Disorders	Associate	36552777
Cleft Lip	Associate	24589633, 34032749
Cleft Lip	Stimulate	26919310
Cleft Palate	Associate	15731757, 17225872, 24589633, 26795696, 32524326
Clubfoot	Associate	35292718
Cognitive Dysfunction	Associate	17889927, 23950911
Colitis	Associate	26589955, 27508510, 29922282
Colitis Ulcerative	Associate	11742810, 15667502, 18186562, 21147109, 26589955, 31584460, 31918598, 32612071, 39252247
Colitis Ulcerative	Stimulate	23695510, 29794741
Collagen Diseases	Associate	26936098
Coloboma	Associate	9933455
Colonic Diseases	Associate	27100181
Colonic Neoplasms	Associate	11784716, 12519076, 1698783, 17692120, 18281501, 18367323, 18774639, 20826792, 25417197, 27540973, 30066920, 30556866, 33570712, 36928437, 37845228, 38031087, 7539800, 7961830 View all (3 more)
Colorectal Neoplasms	Associate	10077641, 10193412, 10389996, 10446110, 11309634, 11725828, 11771728, 11839715, 12046078, 12174377, 12237773, 12480928, 14616787, 15153332, 15754403 View all (164 more)
Colorectal Neoplasms	Stimulate	15187109, 24253505, 34096454, 36077264, 38019256
Colorectal Neoplasms	Inhibit	15574495, 17214746, 34857888, 36700211, 36959211, 7794080
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	24415879
Communicable Diseases	Associate	12734193
Compassion Fatigue	Associate	17225872
Congenital bilateral aplasia of vas deferens	Associate	20100616
Congenital contractural arachnodactyly	Associate	24969562
Congenital heart block	Associate	12960355, 16385528, 18050204, 20499382, 22013113
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	23884466, 24098479, 24380766, 28625142, 29739987, 30927912
Conjunctival Diseases	Associate	29242028
Connective Tissue Diseases	Associate	24380766, 25073432, 31784499, 34807419
Conotruncal cardiac defects	Associate	15358693
Constriction Pathologic	Associate	12651627, 12911563, 16931622, 18756605, 19608867, 20848532, 26428636
Contracture	Associate	31467177
Corneal Dystrophies Hereditary	Associate	20534926, 21462384, 21921985
Corneal dystrophy Avellino type	Associate	26553048
Corneal Dystrophy Band Shaped	Associate	20142847, 34916229
Corneal dystrophy of Bowman layer type 1	Associate	12942051
Corneal Dystrophy Subepithelial Mucinous	Associate	24655442
Corneal Perforation	Associate	26670709
Coronary Aneurysm	Associate	22955109, 36320085
Coronary Artery Disease	Associate	10475771, 21889313, 24533640, 25592103, 28584231, 28829817, 29332922, 30006123, 30307970, 30892430, 32223575, 32513244, 36538237, 40649979
Coronary Artery Disease	Stimulate	30317247
Coronary Artery Dissection Spontaneous	Associate	33866193, 35583931
Coronary Disease	Associate	26383248, 27997991, 35060248
Coronary Restenosis	Associate	1328302, 15531203, 19394554, 26930482, 29332922
Cough	Associate	19463161
COVID 19	Stimulate	32664949, 33961290, 34543980, 37964271, 38578283
COVID 19	Inhibit	32866645
COVID 19	Associate	33092653, 33122784, 33785765, 33947753, 35008594, 35023286, 35379747, 35408809, 35746781, 36066491, 36203591, 37072722, 37307689, 37579743
Cranial Nerve Diseases	Associate	30690794
Craniofacial Abnormalities	Associate	34916229
Craniopharyngioma	Associate	37854185
Craniosynostoses	Associate	15731757, 28804222
Crohn Disease	Associate	14678275, 15951536, 16327498, 17047091, 20489045, 21228771, 23232296, 24074435, 25578979, 26428636, 32031621, 32587447, 35841457, 9923802
Crohn Disease	Stimulate	15667502, 20848532
Cryopyrin Associated Periodic Syndromes	Associate	12483741
Cryptogenic Organizing Pneumonia	Associate	21039988
Cryptorchidism	Associate	25390077
Cutis Laxa Autosomal Dominant	Stimulate	21309044
Cutis Laxa Autosomal Recessive Type I	Associate	20389311
Cyclic neutropenia	Associate	21189329
Cystic Disease Of Lung	Associate	18292811, 18424453, 23950911, 24062613, 27684511, 35525938
Cystic Disease Of Lung	Inhibit	25405607
Cystic Fibrosis	Associate	10596703, 10817792, 12000722, 16207846, 17158822, 18292812, 18424453, 19466271, 19738092, 21337732, 23950911, 24062613, 25134464, 25268501, 25803862 View all (9 more)
Cystic Fibrosis	Stimulate	16127427, 17047099, 23671668, 39543807
Cystic medial necrosis of aorta	Associate	23291965
Cysts	Inhibit	27905298
Cysts	Associate	31443713, 9806561
Cytokine Release Syndrome	Associate	35525938
Cytokine Release Syndrome	Stimulate	36552777
Cytomegalovirus Infections	Stimulate	15031532, 28240260, 31216320, 36016445, 8794351
Cytomegalovirus Infections	Associate	20034645, 22924849, 28683106
Death	Associate	29463556, 35307021
Delayed Graft Function	Associate	24959002
Dementia	Associate	16496359
Dementia Vascular	Associate	10749696
Dementia Vascular	Inhibit	21862019
Demyelinating Diseases	Associate	28103949, 28981455, 31779094, 36499320
Dental Caries	Associate	28779848
Dental Plaque	Associate	32218621, 37200403, 38634280
Dental Pulp Necrosis	Stimulate	31664358
Denys Drash Syndrome	Associate	10586431
Depressive Disorder	Associate	10749696
Depressive Disorder	Inhibit	27414954
Dermatitis Atopic	Inhibit	22427475, 25510765
Dermatitis Atopic	Associate	22968402, 23436698, 27448748, 38066678
Dermatitis Atopic 1	Associate	12370399
Dermatitis Atopic 1	Stimulate	27530865
Dermatitis Contact	Associate	11012755
Dermatomyositis	Associate	19364061
Dermatomyositis	Stimulate	24288551
Desmoid disease hereditary	Associate	23035734
Desmoplastic Small Round Cell Tumor	Associate	8380955
Developmental Disabilities	Associate	24705252, 34050248
Developmental Dysplasia of the Hip	Associate	28860542
Diabetes Gestational	Associate	31099333, 33287755
Diabetes Mellitus	Inhibit	11309160
Diabetes Mellitus	Associate	12213733, 15200451, 16879245, 19539633, 19744994, 21521871, 22623064, 23049541, 23106921, 23841104, 24441198, 24927876, 25086906, 25592103, 25674226 View all (12 more)
Diabetes Mellitus	Stimulate	19175688, 24172699, 35217004, 35379202
Diabetes Mellitus Insulin Dependent 19	Associate	33727573
Diabetes Mellitus Type 1	Associate	20686866, 21900154, 23049541, 23494449, 23637351, 32346380, 35299968, 39464889
Diabetes Mellitus Type 1	Inhibit	22332874, 32936764
Diabetes Mellitus Type 2	Associate	12675860, 17428349, 18676351, 20346437, 23399816, 25086906, 25401107, 25871499, 26064986, 29528020, 30338820, 32567428, 33538080, 33942489, 36209084, 39275851 View all (1 more)
Diabetes Mellitus Type 2	Inhibit	34079246
Diabetes Mellitus Type 2	Stimulate	37446346
Diabetic Angiopathies	Associate	32936764
Diabetic Cardiomyopathies	Associate	34926700
Diabetic Foot	Associate	27102877, 34474187
Diabetic Nephropathies	Associate	11696451, 11879191, 12213733, 14633126, 17034027, 18293167, 18508967, 19858036, 20056746, 20460752, 20833210, 21991303, 22266139, 23399816, 23902294 View all (20 more)
Diabetic Nephropathies	Stimulate	37752256, 37758806
Diabetic Nephropathies	Inhibit	38139275
Diabetic Retinopathy	Associate	26064986, 26617758, 27564721, 29115286, 30595603, 33156339, 35734878
Diarrhea Chronic with Villous Atrophy	Associate	12410804
Diastrophic dysplasia	Associate	27496082
Diffuse Intrinsic Pontine Glioma	Associate	30169876
Disease	Associate	10219772, 12112390, 12410804, 12531888, 18640828, 19261809, 19286977, 23828577, 27836973, 30598637, 31809599, 32317146, 35901086, 38081679, 40065254, 8675633 View all (1 more)
Disease	Stimulate	17362267
Distal myopathy Nonaka type	Associate	23496965
Down Syndrome	Associate	11703351, 25478570, 29244857, 35060072
Drug Hypersensitivity	Inhibit	12884306, 33326762
Drug Hypersensitivity	Associate	15951536, 23884466, 25759826, 26546895, 27530865, 28284979
Drug Related Side Effects and Adverse Reactions	Associate	10203574, 16475708, 16612332, 19661324, 20096948, 26238954, 28333014, 32457348, 40303493
Drug Related Side Effects and Adverse Reactions	Inhibit	12393612, 28619958
Drug Related Side Effects and Adverse Reactions	Stimulate	15496177
Drug Resistant Epilepsy	Stimulate	21315622
Drug Resistant Epilepsy	Associate	27861825, 32785072
Dry Eye Syndromes	Associate	25817729
Duane Retraction Syndrome	Associate	10793000, 24047375, 24210100, 31425971
Duane Retraction Syndrome	Inhibit	19344999
Ductus Arteriosus Patent	Associate	27344223
Dupuytren Contracture	Associate	16563228, 20676061, 21612641, 37894778, 8320323
Dupuytren Contracture	Stimulate	30927912
Dyggve Melchior Clausen syndrome	Stimulate	35379202
Dysentery Bacillary	Stimulate	9393836
Dysequilibrium syndrome	Associate	32964955
Dysgnathia complex	Associate	32100971
Dyskeratosis Congenita	Associate	35605178
Dyskinesia Drug Induced	Associate	12421823
Dyskinesias	Associate	30884781
Dyslipidemias	Associate	26027897
Dysmenorrhea	Associate	14607563, 37884924
Dyspnea	Associate	16456143
Dystonia Dopa responsive	Stimulate	31220088
Eclampsia	Associate	17653872
Ectopia Lentis	Associate	31180551
Eczema	Associate	23884466
Edema	Associate	27589056, 32357159
Embolism Paradoxical	Associate	35937796
Emphysema	Associate	12746043, 15705190, 18670143, 20233420, 23734748, 30335480, 31343404
Emphysematous Cholecystitis	Associate	19811381
Encephalitis	Associate	24339874, 26867675
Endometrial Neoplasms	Associate	16621788, 17150964, 19506550, 20712893, 21771027, 22640183, 27171242, 27527140, 27542208, 27626172, 28841682, 29781387, 29951943, 30510261, 30695033 View all (5 more)
Endometrial Neoplasms	Inhibit	9579831
Endometriosis	Associate	15265761, 16759923, 19505996, 24796928, 25207642, 26577912, 26675296, 28397725, 28760197, 30843336, 31903498, 32348176, 32524577, 33723310, 36551177, 36768775, 37008951, 9806561 View all (3 more)
Endometriosis	Stimulate	21614520, 28300844
Endometritis	Associate	30606202
Endometritis	Stimulate	30922643
Endophthalmitis	Inhibit	27293374
Endotoxemia	Associate	10709066
Endplate Acetylcholinesterase Deficiency	Associate	25372418, 29529124
Enterocolitis Necrotizing	Inhibit	24732104
Enterocolitis Necrotizing	Associate	26670709, 32319640
Eosinophilia	Associate	1726708
Eosinophilia Myalgia Syndrome	Associate	1702819
Eosinophilic Esophagitis	Associate	19796194, 24486052, 24835503, 26656423, 27212082, 28832026, 29029802, 31636346, 32352681, 32712105
Eosinophilic Fasciitis	Associate	1702819
Ependymoma	Associate	8200640
Epidermodysplasia Verruciformis	Associate	1919049
Epidermolysis Bullosa Dystrophica	Associate	22002724, 30693469, 32947957, 33333127, 35779740, 35779741
Epidermolysis Bullosa Dystrophica	Stimulate	30684555, 37161592
Epilepsy	Associate	29483653
Epilepsy rolandic with paroxysmal exercise induced dystonia and writer's cramp	Associate	31469403
Epilepsy Temporal Lobe	Associate	22698689
Epileptic Syndromes	Associate	27782106
Epiretinal Membrane	Associate	30679596
Epstein Barr Virus Infections	Stimulate	11543663
Epstein Barr Virus Infections	Associate	12441075, 18024394, 18621908
Erectile Dysfunction	Stimulate	24075003
Erectile Dysfunction	Associate	30333254
Erythema	Associate	22537351
Erythema elevatum diutinum	Associate	15235604, 26293758
Erythema Multiforme	Associate	10571738
Erythema Nodosum	Stimulate	11122237
Esophageal Neoplasms	Associate	18426913, 19360286, 20056838, 20300551, 22393371, 24684802, 24756761, 25554686, 30880778, 34725559, 35870178
Esophageal Squamous Cell Carcinoma	Associate	10789724, 12209716, 15736400, 18439605, 24798237, 25464508, 25897987, 27036032, 27987372, 29379981, 30280774, 30880778, 32769441, 33760133, 34016746 View all (5 more)
Esophageal Squamous Cell Carcinoma	Inhibit	25064463
Esophagitis	Associate	19796194, 23334061, 26656423, 29953975
Essential Hypertension	Associate	16609677, 19922630, 20356380, 20459371, 24687999, 29201909
Evans Syndrome	Associate	30784322
Exfoliation Syndrome	Associate	15665347, 35201654
Exfoliation Syndrome	Stimulate	33914756, 34870675
Factor VII Deficiency	Stimulate	29326176
Fallopian Tube Diseases	Stimulate	33092547
Familial Primary Pulmonary Hypertension	Associate	22474227, 33478117, 35427808
Fanconi Anemia	Associate	33570643, 35605178, 37021532
Fatigue Syndrome Chronic	Stimulate	15280416
Fatigue Syndrome Chronic	Associate	22118314, 29202780
Fatty Liver	Associate	16344856, 19401628, 31243135, 32498337
Fatty Liver	Inhibit	31087761
Fatty Liver Alcoholic	Associate	32330605, 33992698
Femoral Neck Fractures	Associate	17627086
Fetal Growth Retardation	Associate	25942476, 28901463, 35090410
Fibrocartilaginous embolism	Associate	24618041, 27075568, 33336720
Fibroma Desmoplastic	Associate	15365564
Fibromatosis Aggressive	Associate	23035734
Fibromatosis Gingival	Stimulate	34777248
Fibromuscular Dysplasia	Associate	24732132
Fibrosarcoma	Associate	16547158, 18158922, 9933644
Fibrosis	Associate	10411682, 10444270, 10594789, 10817792, 11413354, 11696451, 11703351, 12213733, 12787426, 12905481, 12960355, 14531781, 14717921, 14761892, 15049387 View all (264 more)
Fibrosis	Stimulate	11413354, 11422744, 11849412, 16127427, 23324179, 24049150, 24333536, 24496160, 24757288, 25948488, 26542979, 28858296, 29321510, 30143691, 30303512 View all (31 more)
Fistula	Associate	11849456, 24250816
Focal Cortical Dysplasia	Associate	32785072
Food Hypersensitivity	Inhibit	12884306
Food Hypersensitivity	Associate	23884466, 29922282
Fractures Bone	Associate	7529233
Fragile X Syndrome	Associate	10780855, 36012539
Frontotemporal Lobar Degeneration	Stimulate	31081340
Fuchs' Endothelial Dystrophy	Associate	26302187, 28754918, 31469403
Gait Disorders Neurologic	Associate	30690794
Gallbladder Diseases	Associate	26111189
Gallbladder Neoplasms	Stimulate	24310606
Gallbladder Neoplasms	Associate	28060377, 28611292, 32406793
Ganglioneuroblastoma	Associate	8380955
Gastritis	Stimulate	27196487, 31320834
Gastritis Atrophic	Inhibit	32947843
Gastritis Atrophic	Associate	34104107, 35905420
Gastro enteropancreatic neuroendocrine tumor	Associate	34037532
Gastroesophageal Reflux	Associate	31369967
Gastrointestinal Diseases	Associate	23884466
Gastrointestinal Neoplasms	Associate	15574495, 30268436
Gastrointestinal Stromal Tumors	Associate	21390241
GATA2 Deficiency	Associate	36498937
Gaucher Disease	Associate	21683322
Genee Wiedemann syndrome	Stimulate	33218077
Genetic Diseases Inborn	Associate	11278244, 17336165, 22895257, 25113270
Genetic Predisposition to Disease	Associate	19755996
Germinoma	Associate	21696393
Gerodermia osteodysplastica	Associate	25309050
Gerstmann Straussler Scheinker Disease	Associate	20720360
Giant Cell Arteritis	Associate	40084998
Giant Cell Tumor of Bone	Associate	1756472, 38214358, 7977641, 8500096
Giant Cell Tumors	Associate	1756472, 8698303
Gingival Overgrowth	Associate	22395513, 24560449
Gingivitis	Associate	34234776
Glaucoma	Associate	15895394, 20945401, 21546528, 26396484, 27229292, 28400560, 29509235, 33746571, 33832461, 34156425, 34940783, 35142784, 36835591
Glaucoma	Stimulate	25811482
Glaucoma Angle Closure	Stimulate	25811482
Glaucoma Angle Closure	Associate	33832461
Glaucoma Open Angle	Associate	19145252, 23940598, 26820987, 29752408, 35461232, 35689009, 36180030
Glaucoma Open Angle	Stimulate	25811482, 34870675
Glioblastoma	Associate	10783396, 11390472, 17469181, 18829576, 19192267, 19574499, 20419098, 23249750, 23776187, 24517116, 25165192, 25256711, 25315188, 25813152, 25832460 View all (30 more)
Glioblastoma	Stimulate	29642484, 33494271
Glioblastoma	Inhibit	30226551, 31784984
Glioma	Associate	11390472, 15584904, 17292826, 17414317, 17440061, 19192267, 19431147, 20150362, 20511186, 21359495, 21775821, 22104964, 22752645, 25165192, 25529192 View all (24 more)
Glioma	Stimulate	26317904
Glioma	Inhibit	29517201, 8054266, 8200640
Glioma of Brain Familial	Associate	32521909
Gliosarcoma	Associate	37169340
Gliosis	Associate	28981455, 31779094
Glomerulonephritis	Associate	10504488, 12009422, 12911160, 14531804, 14745123, 15462102, 15906952, 16586546, 16612332, 19693466, 19726546, 22119820, 22879939, 25026939, 28815607, 7996808, 8050182, 8264131, 8995728 View all (4 more)
Glomerulonephritis IGA	Associate	11359449, 15906952, 18421480, 18496506, 19258388, 19693466, 19946746, 21494642, 24023680, 25523477, 27044423, 31728204, 8301931
Glomerulonephritis IGA	Stimulate	28273242, 36648741, 8821830
Glomerulonephritis Membranous	Associate	10620196, 12969126, 35172688
Glomerulosclerosis Focal Segmental	Associate	11786088, 14531804, 9150474
Glomerulosclerosis Focal Segmental	Stimulate	26322947
Glucocorticoid Receptor Deficiency	Associate	28046097, 29654633
Glucose Intolerance	Stimulate	25086906
Glucosephosphate Dehydrogenase Deficiency	Stimulate	33050491
Glycosuria Renal	Associate	11168939, 15086490, 19158077, 25587706, 29551286, 30383875
Glycosuria Renal	Stimulate	37758806
Goiter	Associate	29131274
Goiter Nodular	Stimulate	23918305
Gout	Associate	36550178
Gout	Stimulate	36850003
Graft Occlusion Vascular	Associate	1328302
Graft vs Host Disease	Associate	11835352, 17378698, 18344931, 19392797, 19713222, 20190732, 20457266, 20548127, 21629186, 32818226
Graft vs Host Disease	Stimulate	20446793
Granuloma Plasma Cell	Associate	25189096
Granulomatosis with Polyangiitis	Associate	8697616
Granulosa Cell Tumor	Associate	23322721, 24416423, 35938797
Granulosa cell tumor of the ovary	Associate	33207819, 37993664, 8500096
Graves Disease	Associate	18190611, 27345036, 29266775, 29739987
Graves Disease	Stimulate	20926009, 27340508
Graves Disease	Inhibit	2921318
Graves Ophthalmopathy	Associate	32176314, 33597925, 34202024, 34680057, 35563653, 37272763
Growth Disorders	Inhibit	16723698
Growth Disorders	Associate	26675296, 34916229
Growth mental deficiency syndrome of Myhre	Associate	24398790, 33428109
HAIR AN syndrome	Associate	38043753
Hashimoto Disease	Associate	18190611, 25412700, 33125100
Hashimoto Disease	Stimulate	35871446
Head and Neck Neoplasms	Associate	16478646, 28945296, 38200037
Heart Arrest	Associate	31287539
Heart Defects Congenital	Associate	15731757, 26044615
Heart defects limb shortening	Associate	25174448
Heart Diseases	Associate	10733758, 15358693, 22513132, 23884466, 27098600, 29462303, 30739867, 30971721, 32443848, 35328443, 35427808, 37298503, 37930292
Heart Diseases	Stimulate	23342164, 26338706, 40095970
Heart Failure	Associate	15200451, 25298166, 30272299, 31124999, 31223316, 33016206, 35672400, 36204659, 38256034
Heart Failure	Stimulate	31072570
Heart Septal Defects	Associate	15358693
Heart Valve Diseases	Associate	28377507, 35315241
Helicobacter Infections	Associate	16085918
HELLP Syndrome	Associate	37950229
HEM dysplasia	Associate	24559391
Hemangiosarcoma	Associate	23599148
Hematologic Diseases	Associate	18024394
Hematologic Neoplasms	Inhibit	24256874
Hematologic Neoplasms	Associate	31211692, 37121717, 37925591
Hematoma Subdural Chronic	Associate	24305026
Hematuria	Associate	35474271
Hemihyperplasia Isolated	Stimulate	32968152
Hemochromatosis	Associate	10188109
Hemoglobinuria Paroxysmal	Associate	11298593
Hemolysis	Associate	33062074
Hemorrhage	Associate	23468366
Heparin Cofactor II Deficiency	Associate	29242028
Hepatic Encephalopathy	Associate	36293192
Hepatitis B	Stimulate	25716231
Hepatitis B	Associate	26648552, 33506937, 35022275
Hepatitis B Chronic	Associate	16586546, 23395388, 34168644
Hepatitis B Chronic	Stimulate	25716231
Hepatitis C	Associate	11242803, 16627984, 21384510, 24496160, 25966218, 27123854, 29061957, 31243135, 34360721, 35022275, 36215278
Hepatitis C Chronic	Associate	15800982, 16425360, 17600343, 18092051, 24496160, 32962821, 35469194, 36466817
Hepatitis Viral Human	Associate	17477814
Hepatoblastoma	Associate	17006932
Hereditary Breast and Ovarian Cancer Syndrome	Inhibit	11267935
Hereditary Breast and Ovarian Cancer Syndrome	Associate	19574499, 19937272, 21890597, 24146803, 28678584, 30027292, 34911484
Hereditary leiomyomatosis and renal cell cancer	Associate	1632458, 26919310, 7745117
Hereditary pancreatitis	Associate	35469194
Hereditary renal agenesis	Associate	12496270, 14597629
Hernias Diaphragmatic Congenital	Associate	26333573
Herpes Labialis	Stimulate	32735468
Herpes Simplex	Associate	31136615
Heterotaxy Syndrome	Associate	26111189
Hirschsprung Disease	Associate	23527089
Histiocytoma Malignant Fibrous	Associate	7691245
Histiocytosis Langerhans Cell	Associate	10975922, 22949932
HIV Infections	Stimulate	11122240, 1700428, 17477814, 25784439, 28314381, 36006052, 8149667, 9150474
HIV Infections	Associate	20433405, 21303360, 22542711, 22859956, 25802474, 26883727, 29439673, 29749506, 34991160, 35485686, 36110864, 37042759, 39742336, 9987082
HIV Infections	Inhibit	36016445
Hodgkin Disease	Associate	1632458, 17720884, 22167753, 2904450, 29315015, 7745117
Hodgkin Disease	Inhibit	17644739
Huntington Disease	Associate	22748967, 26056083, 26651603, 33049985
Hyaline Membrane Disease	Associate	19056532
Hypercalcemia	Associate	2891388
Hypercalciuria Absorptive 2	Inhibit	18480302
Hypercholesterolemia	Associate	36927534
Hypereosinophilic Syndrome	Associate	1726708, 26112417, 34459778
Hypergammaglobulinemia	Associate	31770396
Hyperglycemia	Associate	25086906, 31625803
Hyperglycemia	Stimulate	8691733
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	21640843, 24204837
Hyperhomocysteinemia	Stimulate	34296783
Hyperlipoproteinemia Type II	Stimulate	15840021
Hyperoxia	Stimulate	34601016
Hyperpigmentation	Associate	32174800
Hyperplasia	Stimulate	12911563, 24716596, 26428636
Hyperplasia	Associate	1908092, 20954112, 21781173, 30984775
Hypersensitivity Delayed	Inhibit	16889541
Hypersensitivity Delayed	Associate	7615854
Hypersensitivity Immediate	Stimulate	39201708
Hypersensitivity Immediate	Associate	9061041
Hypertelorism	Associate	34916229
Hypertension	Stimulate	10725360, 16482098, 26502942, 39595551
Hypertension	Associate	12675860, 14531781, 18293167, 18821144, 19330901, 19768163, 25856002, 26064986, 26198819, 28827564, 31147455, 32354559, 33652665
Hypertension Pregnancy Induced	Inhibit	29846432
Hypertension Pregnancy Induced	Associate	37716201
Hypertension Pregnancy Induced	Stimulate	39503530
Hypertension Pulmonary	Associate	11015450, 12225948, 16227320, 17336165, 21625455, 31141166, 31703702, 37731513
Hypertension Resistant to Conventional Therapy	Associate	39971624
Hyperthyroidism	Stimulate	29131274
Hypertrophy	Stimulate	12531888, 17369289, 22879939, 31409892, 35406794, 37652257
Hypertrophy	Associate	17428349, 24782191, 24823657, 26428636, 27569062, 28951244, 32790806, 39653186
Hypertrophy Left Ventricular	Associate	15049387, 18821144
Hyperuricemia	Associate	15200452, 36850003
Hypoplastic Left Heart Syndrome	Stimulate	23871585
Hypothyroidism	Associate	18190611
Hypothyroidism Congenital Nongoitrous 2	Associate	31903498, 36768775
Hypotrichosis Localized Autosomal Recessive 1	Associate	25240937
Hypoxia	Stimulate	11115069, 12225948, 16014625, 19187226, 22705563, 22974282, 23067574, 23690936, 24180698, 26800359, 31422771, 34197482, 34367731, 34601016, 35457151, 36265878 View all (1 more)
Hypoxia	Associate	1373333, 15220111, 18050204, 19036873, 21209004, 21680037, 23723999, 23786654, 23871585, 25851169, 27124111, 27622654, 27909731, 28397725, 29699590 View all (9 more)
Hypoxia	Inhibit	19951945
Hypoxia Brain	Associate	15220111, 23723999, 24036252, 25867965
Hypoxia Brain	Stimulate	19036873, 25851169, 35841007, 36835007, 36928344, 37377902
Hypoxia Brain	Inhibit	20032117
Idiopathic Noncirrhotic Portal Hypertension	Associate	19608867, 26317806, 26549939, 27268609, 31770396, 31905709, 38365182
Idiopathic Noncirrhotic Portal Hypertension	Stimulate	36982376
Idiopathic Pulmonary Fibrosis	Associate	10188109, 16948840, 18795102, 20212457, 20483575, 20685750, 22014187, 23031257, 23043088, 23223528, 23755232, 23815594, 24376648, 24515257, 24790080 View all (37 more)
Idiopathic Pulmonary Fibrosis	Stimulate	11713352, 12882453, 22295148, 28128990, 28178340, 29321510, 38117249
Idiopathic subglottic tracheal stenosis	Associate	34111429
IgA Deficiency	Stimulate	27044423
IgA Deficiency	Associate	8544410
IgA Vasculitis	Associate	11966774, 1908092, 28273242, 9893571
Ige Responsiveness Atopic	Associate	17333284
Ileal Diseases	Associate	20722024
Immune System Diseases	Associate	10354153, 22107611, 28314381, 30320351
Immune System Diseases	Stimulate	37096442
Immunoglobulin G4 Related Disease	Associate	12974945, 22824292, 25571893, 27358392, 33512463, 34729958, 35269701
Immunoglobulin G4 Related Disease	Stimulate	26311608
Immunoglobulin Light chain Amyloidosis	Associate	18923384
Immunologic Deficiency Syndromes	Associate	1700428, 18385519, 25565391, 28417861
Infections	Associate	11543663, 1372988, 15596839, 1705278, 18417583, 20179236, 21430262, 22970254, 25113249, 26536616, 28284979, 30832593, 31216320, 32962821, 36215278, 36611878, 8995752 View all (2 more)
Infections	Inhibit	15542656, 21179465, 31092295
Infections	Stimulate	17151785, 23150092, 31205451, 34835071
Infectious Mononucleosis	Associate	18024394
Inferior Wall Myocardial Infarction	Inhibit	23696918
Inferior Wall Myocardial Infarction	Associate	27393708
Infertility	Inhibit	37108732
Inflammation	Inhibit	10233685, 10359806, 10678961, 11418694, 11738291, 12202878, 15280416, 17697117, 18716928, 20497023, 21235789, 21862019, 23121667, 24339874, 26867675 View all (20 more)
Inflammation	Associate	10700426, 10749696, 11565192, 11849456, 11925630, 11966774, 12000710, 12176809, 12370399, 12754205, 14600158, 14678275, 15027908, 15086314, 15213101 View all (213 more)
Inflammation	Stimulate	20380722, 22573806, 23695510, 25862016, 25890309, 27782111, 30575211, 32245324, 32835907, 34525361, 34639099, 34651657, 35563653, 35902972, 38085254, 39804841 View all (1 more)
Inflammatory Bowel Diseases	Associate	11518734, 11742810, 15667502, 20944558, 22584294, 23492772, 26660358, 27508510, 27782111, 29420705, 29483653, 29922282, 32390702, 32612071, 34561227 View all (4 more)
Inflammatory Bowel Diseases	Inhibit	27468194
Inflammatory Breast Neoplasms	Associate	23396049, 26207636, 33902690
Insulin Resistance	Associate	19401628, 19763090, 27903298, 30461200, 38166771
Intellectual Disability	Associate	15731757
Internal Hernia	Stimulate	33410269
Interstitial Pneumonitis Desquamative Familial	Associate	24825461
Intervertebral Disc Degeneration	Associate	15340826, 15980999, 25372418, 27075568, 29636026, 31432173, 32873329, 35840955, 37784117
Intervertebral disc disease	Associate	24551286, 34122424
Intervertebral Disc Displacement	Associate	15980999, 28260009, 34122424
Intestinal Diseases	Associate	15951536, 33803197, 36615756
Intestinal Diseases	Stimulate	22294131
Intestinal Obstruction	Associate	9923802
Intraabdominal Infections	Associate	31480453
Intracranial Aneurysm	Associate	15731757, 26198819, 30742604, 36451838
Intracranial Arteriosclerosis	Associate	21679448
Intracranial Arteriovenous Malformations	Associate	22643235, 32560555, 36198763
Intracranial Hemorrhage Traumatic	Associate	33955515
Invasive Pulmonary Aspergillosis	Associate	24274595
Iron Deficiencies	Associate	37175630
Iron Overload	Stimulate	35672400
Irritable Bowel Syndrome	Associate	15951536, 21803306, 29698332, 33441166
Ischemia	Associate	10709066
Isolated Noncompaction of the Ventricular Myocardium	Associate	27642787
Isotretinoin embryopathy like syndrome	Associate	17961254
Jaundice	Associate	8567993
Jaw Neoplasms	Associate	27279422
Job Syndrome	Associate	12694256
Juvenile gout	Associate	36850003
Juvenile polyposis syndrome	Associate	15235019, 20949628, 21412070
Kartagener Syndrome	Stimulate	8898920
Kashin Beck Disease	Associate	32816579
Keloid	Associate	15800982, 24250248, 24436441, 27025872, 27909731, 33436666, 33541932, 3422443, 35953762, 36183172, 36608994, 37091895
Keloid	Stimulate	16467496
Keratoacanthoma	Associate	25579378
Keratoconus	Stimulate	24147544
Keratoconus	Associate	25247416, 26015770, 28145428, 29860458, 34478492, 36051483, 37108600, 37714423
Kernicterus	Stimulate	33263631
Kidney Cortex Necrosis	Associate	11073823
Kidney Diseases	Associate	10586431, 10594789, 10725360, 11073823, 11879191, 12009422, 12217862, 12787405, 12911160, 14531781, 14761892, 16598193, 17003485, 17361117, 18293167 View all (29 more)
Kidney Diseases	Stimulate	11849412, 16612332, 36292960, 37752256
Kidney Failure Chronic	Stimulate	10725360, 14531781, 19768163, 31929749, 40751815, 9507209
Kidney Failure Chronic	Associate	11786088, 11786115, 15086490, 25871499, 31464346, 37439962
Kidney Neoplasms	Stimulate	10594789
Kidney Neoplasms	Associate	11073823, 11555647, 26848077, 31449970, 35179216, 38148073
Kidney Tubular Necrosis Acute	Stimulate	16612332
Kimura Disease	Associate	27023391
Klippel Feil Syndrome	Associate	25634178
Klippel Trenaunay Weber Syndrome	Associate	10586431
Laminopathies	Associate	32585971
Laryngeal Neoplasms	Associate	32362625
Laryngitis	Associate	23071866
Laryngotracheal Stenosis Progressive with Short Stature and Arthropathy	Associate	28715559, 32557663
Lattice corneal dystrophy type 1	Associate	19956413, 24505203
Lead Poisoning Nervous System	Associate	23748100
Left sided gallbladder	Associate	29089047
Leg Ulcer	Associate	16681647
Leiomyoma	Associate	15374708, 18248652, 19700613, 19906824, 25596622, 25713613, 30871768, 33036796, 35032343, 36313223, 36771423
Leishmaniasis Cutaneous	Associate	15716079, 8112853
Lens Subluxation	Associate	31180551
Leprosy	Associate	11122237, 12641657, 22429842, 30540075, 35703715, 37153623, 9737674
Leprosy Borderline	Stimulate	11122237
Leprosy Lepromatous	Stimulate	11122237, 12641657
Leprosy Lepromatous	Associate	24454972
Leukemia	Associate	10907639, 1737088, 19406989, 2070083, 2358774, 24304929, 2460153, 7521696, 7780149, 9531610
Leukemia	Inhibit	36959211, 7535588
Leukemia Biphenotypic Acute	Associate	32509885
Leukemia Erythroblastic Acute	Associate	8898920
Leukemia Large Granular Lymphocytic	Associate	17156396, 17162379
Leukemia Lymphocytic Chronic B Cell	Associate	12644014, 17349636, 18492692, 22207686, 22643838, 22905131, 32227331, 35193595, 9028325, 9159168, 9207409
Leukemia Lymphoma Adult T Cell	Associate	12393612, 20061557, 2358774, 2891388
Leukemia Lymphoma Adult T Cell	Stimulate	2789474
Leukemia Megakaryoblastic Acute	Stimulate	11703351
Leukemia Monocytic Acute	Associate	18492113
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	20548127, 21501493, 23651669, 24819026, 26722450, 36959211, 7780147, 9746772
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	23180012, 28836580
Leukemia Myelogenous Chronic BCR ABL Positive	Inhibit	2460153
Leukemia Myeloid	Associate	10210318, 7521696
Leukemia Myeloid	Inhibit	1512249
Leukemia Myeloid Acute	Associate	21606166, 23179394, 28454099, 29773599, 31373163, 31600200, 3291977, 33073700, 33253299, 33539590, 40184725, 7685204
Leukemia Myeloid Acute	Inhibit	2891388, 33083479
Leukemia Myeloid Acute	Stimulate	37233879
Leukemia Prolymphocytic T Cell	Associate	33596640, 9207409
Leukemia Promyelocytic Acute	Associate	1737088, 21345218
Leukemia T Cell	Associate	17408459, 18492113
Leukoencephalopathy Progressive Multifocal	Associate	14987161
Leukoencephalopathy Progressive Multifocal	Stimulate	23076257
Leydig Cell Tumor	Associate	21126344
Lichen Planus Oral	Associate	14675171, 27544215
Light Fixation Seizure Syndrome	Associate	32973329
Lipodystrophy	Associate	22926483
Liposarcoma	Associate	30824765
Livedoid Vasculopathy	Associate	10733758, 22836090
Liver Cirrhosis	Associate	12000722, 14606082, 15349911, 15800982, 17477814, 1900574, 19506550, 19794996, 19878580, 20212457, 20230822, 20357999, 20531292, 21303922, 21384510 View all (28 more)
Liver Cirrhosis	Stimulate	21606534, 26097586, 31166951, 33682288
Liver Cirrhosis Alcoholic	Stimulate	11925630
Liver Cirrhosis Alcoholic	Associate	21494076
Liver Cirrhosis Biliary	Associate	11966774, 17158635, 25896390, 33977112
Liver Cirrhosis Biliary	Stimulate	38228248
Liver Diseases	Associate	18059363, 18092051, 1900574, 20212457, 21384510, 24905921, 33682288, 35138513, 35427808, 35485686, 36466817, 37962490, 38068980, 8567993
Liver Diseases	Stimulate	24669910
Liver Diseases Alcoholic	Associate	11925630, 38146363
Liver Failure	Associate	20230822, 21424084, 25716231, 26909983, 29690860, 30926424, 34686321, 35051234, 36482069, 9622588
Liver Failure	Stimulate	26097586, 35022275
Liver Failure Acute	Associate	8567993
Liver Neoplasms	Associate	19169878, 20380719, 37053209
Liver Neoplasms	Stimulate	26301107
Lobomycosis	Associate	36183172
Loeys Dietz Syndrome	Associate	16550171, 23884466, 24045763, 24193348, 25116393, 25163805, 25835445, 28679693, 30170566, 31915033, 32022471, 32062130, 32152251, 33416497, 34807419 View all (5 more)
Lown Ganong Levine Syndrome	Associate	21527583
Lumbar Stenosis Familial	Stimulate	35904178, 36185336
Lumbar Stenosis Familial	Associate	36277021, 39653186
Lung Diseases	Associate	12905481, 16207846, 16365456, 16908447, 18563170, 19036873, 19466271, 19812599, 21039988, 21337732, 21625455, 22659883, 23950911, 24062613, 24498427 View all (12 more)
Lung Diseases	Inhibit	27905298
Lung Diseases	Stimulate	38158808
Lung Diseases Interstitial	Associate	21241464, 24574232, 39560968
Lung Diseases Interstitial	Stimulate	22924849
Lung Injury	Associate	12754187, 14576166, 30155985, 35525938, 36069235
Lung Injury	Inhibit	34483230
Lung Neoplasms	Associate	10748131, 10757810, 10945495, 1655420, 17600311, 17676583, 19047146, 19234174, 21360479, 21625455, 22045191, 22393947, 22571197, 22752005, 23094028 View all (62 more)
Lung Neoplasms	Stimulate	15187109, 25919050, 26187636, 28266181, 36097589
Lupus Erythematosus Discoid	Associate	30130620
Lupus Erythematosus Systemic	Associate	15457456, 17364494, 1747946, 17579298, 19020994, 19173720, 19841178, 20334681, 21708033, 22389764, 22621248, 22966240, 23401079, 23790231, 32602296 View all (6 more)
Lupus Erythematosus Systemic	Stimulate	16221206, 24062776, 26322947, 33198645
Lupus Erythematosus Systemic	Inhibit	18052965
Lupus Nephritis	Associate	15457456, 8050182
Lupus Nephritis	Stimulate	8821830
Lymphangioleiomyomatosis	Associate	38195527
Lymphatic Metastasis	Associate	12046078, 14669355, 16807982, 20506050, 22278155, 2331446, 25113249, 25993985, 30485902, 33271824, 8393616
Lymphatic Metastasis	Stimulate	15754403, 23918305, 24418088, 25338997, 26597083, 26848077, 33229445, 37971439
Lymphatic Metastasis	Inhibit	17692120
Lymphoma	Associate	1312308, 20207982, 2066357, 26464657, 2898211
Lymphoma	Stimulate	2789474
Lymphoma B Cell	Associate	17339425, 20017807, 21092277, 21131601, 22621932, 22819827, 23555036, 24569779, 26464657
Lymphoma B Cell Marginal Zone	Associate	15507668, 22110251
Lymphoma Extranodal NK T Cell	Associate	26497849
Lymphoma Follicular	Associate	15695537, 33881493
Lymphoma Follicular	Stimulate	24162786
Lymphoma Large B Cell Diffuse	Associate	20133617, 31886296, 35713434, 36831263
Lymphoma Large B Cell Diffuse	Stimulate	24162786
Lymphoma Large Cell Anaplastic	Associate	2898211
Lymphoma Mantle Cell	Associate	16098065
Lymphoma Non Hodgkin	Associate	23555036, 24569779, 27978994
Lymphoma Primary Effusion	Associate	22915806
Lymphoma T Cell	Associate	16766651, 37106379, 8016105
Lymphoma T Cell Cutaneous	Associate	10910922, 15514008, 22936659, 25681335
Lymphoma T Cell Peripheral	Associate	10748876
Lymphoproliferative Disorders	Inhibit	16889541
Lymphoproliferative Syndrome X Linked 2	Associate	27632686
Macular Degeneration	Inhibit	29795291, 31700227
Macular Degeneration	Associate	30642396, 33510953, 35186229, 39959181
Macular Degeneration	Stimulate	9059252
Macular dystrophy retinal 1 North Carolina type	Associate	26305530
Malaria	Associate	36193307
Malaria Cerebral	Associate	16705810, 20011600
Malignant mesenchymal tumor	Associate	26919310, 28119430, 34440820
Mandibular Injuries	Associate	34916229, 35757474
Mania	Inhibit	27270858
Marfan Syndrome	Associate	17242066, 18591412, 18606132, 21683322, 21982653, 22178754, 23291965, 23840350, 24398790, 24720641, 25113270, 25656438, 25979247, 29174139, 29198452 View all (15 more)
Marfan Syndrome	Stimulate	22479353, 23428920, 30920150, 36972239, 37445606
Mast Cell Activation Disorders	Associate	27095287
Mastocytosis Systemic	Associate	21309044
Medullary cystic kidney disease 1	Associate	26974954
Medulloblastoma	Associate	31547819, 37821528, 8200640
Melanoma	Inhibit	10844567, 2056188, 22496449, 25885043, 35669782
Melanoma	Associate	11278410, 15843517, 16835788, 16988787, 17096021, 17565341, 20856146, 21427239, 21464823, 21477078, 21547596, 21673687, 22307139, 23063511, 23792459 View all (33 more)
Melanoma	Stimulate	23624802, 37481560
Melanoma Amelanotic	Associate	36899279
Melanoma Cutaneous Malignant	Associate	17565341, 25885043, 32968152, 35131256
Melorheostosis	Associate	32289153
Meningioma	Associate	10638966, 1325741, 20685720, 23222509, 25681310
Meningioma	Stimulate	23285163
Meningitis Bacterial	Associate	16705810
Meningoencephalitis	Stimulate	7890425
Mental Disorders	Associate	36632818
Mesangial sclerosis diffuse	Associate	29708439
Mesenteric Vascular Occlusion	Associate	23258796
Mesothelioma	Stimulate	36901697
Mesothelioma Malignant	Associate	30609805, 37686215
Metabolic Syndrome	Inhibit	20384863
Metabolic Syndrome	Associate	29051557
Metaplasia	Associate	18385519
Microcephaly	Associate	30121258
Micronuclei Chromosome Defective	Stimulate	17621264
Microphthalmia Syndromic 10	Associate	29483653
Microsatellite Instability	Associate	31221124, 32493700
Microvascular Angina	Associate	22732936
Migraine Disorders	Associate	19559392, 33541932
Migraine without Aura	Associate	19559392
Milk Hypersensitivity	Associate	23917667
Mitchell Riley Syndrome	Associate	34715892
Mitochondrial Diseases	Stimulate	37569523, 37626894
Mitral Valve Insufficiency	Associate	18303197
Mitral Valve Prolapse	Associate	28679693
Monocyte Chemotactic Disorder	Associate	33942489
Mosaic variegated aneuploidy syndrome	Associate	27926867
Mouth Diseases	Associate	14607563, 18499657, 25569361, 25579378, 28811677, 36768775
Mouth Diseases	Stimulate	37884924
Mouth Neoplasms	Associate	12027954, 15161003, 18234959, 22103462, 23378237, 23778523, 25744234, 32630719, 33125101, 36170816
Moyamoya Disease	Associate	28596558, 37684266
Mucocutaneous Lymph Node Syndrome	Inhibit	15270865, 20718783, 37506144
Mucocutaneous Lymph Node Syndrome	Associate	21127203, 22955109, 23483985
Mucolipidoses	Inhibit	32357547
Mucopolysaccharidosis III	Associate	24711139
Mucositis	Associate	32612071, 9923802
Multiple Myeloma	Associate	11030205, 11418694, 15180863, 16278310, 19201832, 26056083, 26433312, 28249894, 29565496, 30854481, 32922390, 36731340, 40135312, 8634441, 9575147
Multiple Pulmonary Nodules	Associate	36384712
Multiple Sclerosis	Associate	18366677, 21093933, 25780887, 28103949, 28981455, 31779094, 33480235, 35094644, 35266286, 35767891, 36499320, 37219933, 39985494, 9710434
Multiple Sclerosis	Inhibit	26768647
Multiple Sclerosis Relapsing Remitting	Associate	33480235, 35266286, 35767891, 37833895
Multiple Sclerosis Relapsing Remitting	Stimulate	35328606
Muscular Atrophy	Associate	25516419
Muscular Diseases	Associate	21452302
Muscular Diseases	Stimulate	26847457
Muscular Dystrophy Duchenne	Associate	17059371, 22431140, 27745838, 32359374, 32592467, 34360002
Muscular Dystrophy Duchenne	Stimulate	7635950
Musculoskeletal Abnormalities	Associate	24193348
Myelodysplastic Syndromes	Associate	11435325, 17408459, 18081437, 29773599, 30249787, 32045384, 33050756, 33687432, 7685204, 9332304
Myelodysplastic Syndromes	Stimulate	21189329
Myelodysplastic Syndromes	Inhibit	25608238, 35367529
Myeloproliferative Disorder Chronic with Eosinophilia	Associate	22119820, 23010686
Myeloproliferative Disorders	Associate	11703351
Myeloproliferative Syndrome Transient	Associate	11703351
Myocardial Infarction	Stimulate	10475771, 24533640, 36759072
Myocardial Infarction	Associate	18312614, 22513132, 26658659, 31147455, 38290462
Myocardial Ischemia	Associate	15200451, 31959759
Myocardial Stunning	Stimulate	11782760
Myocarditis	Associate	21422001
Myopathies Structural Congenital	Associate	40339499
Myopia	Associate	16807529, 34302427, 35276183, 36289352
Myositis Ossificans	Associate	24705252, 26621707, 30429363, 31745065, 36768622
Myostatin related muscle hypertrophy	Associate	20190034
Myotonia with Skeletal Abnormalities and Mental Retardation	Associate	32289153
Myotonic Dystrophy	Associate	21414848, 23049541, 24720641, 26806620
Nasal Polyps	Associate	15361357, 1569205, 19639723, 21898422, 23663486, 27393708, 28779150, 29367682, 34953475, 36447209, 36841712, 37382248, 39744949
Nasal Polyps	Stimulate	25973005, 35682987
Nasopharyngeal Carcinoma	Associate	16995954, 20416076, 24504675, 24528033, 24952889, 25909165, 28198387, 29017171, 29991129, 30151927, 30602452, 31138194, 31328403, 32573058, 33122398 View all (5 more)
Necrosis	Associate	16556259
Neointima	Associate	8698303
Neonatal hemochromatosis	Associate	26909983
Neoplasm Invasiveness	Associate	15754403, 21523732, 23705641, 24727589, 31027492
Neoplasm Metastasis	Stimulate	12107103, 21624123, 21654215, 21914811, 22126971, 22539990, 24418088, 25993985, 26267863, 26581907, 26848077, 28726720, 28767724, 31924735, 33649791 View all (4 more)
Neoplasm Metastasis	Associate	12174377, 12778073, 14597629, 15754403, 16086840, 16959768, 17264880, 17325209, 17425807, 17469181, 17692120, 18219106, 18239055, 18567806, 19838175 View all (163 more)
Neoplasm Metastasis	Inhibit	19914962, 23536895, 27270440, 28302086, 35475918
Neoplasms	Associate	10233685, 10333714, 10389996, 10433946, 10485843, 10618379, 10751416, 10777512, 10781087, 10839293, 10945495, 10947082, 10984481, 11158583, 11309634 View all (799 more)
Neoplasms	Inhibit	10789724, 11267935, 11784716, 11918080, 12209716, 12531888, 12947087, 14726675, 14747535, 14990603, 15467438, 16135802, 16908595, 16988787, 17204482 View all (75 more)
Neoplasms	Stimulate	11279086, 15365564, 16497872, 18299279, 18385519, 18515987, 18685848, 18774639, 19169878, 19289577, 20196115, 20300551, 22103462, 23807047, 24335925 View all (18 more)
Neoplasms Adipose Tissue	Associate	25518011, 31434495
Neoplasms Basal Cell	Associate	21649908
Neoplasms Germ Cell and Embryonal	Associate	30315637, 32441446
Neoplasms Glandular and Epithelial	Associate	18385519, 22138668, 23651589, 24958208
Neoplasms Mesothelial	Associate	19855086, 37989866
Neoplasms Radiation Induced	Associate	23334061
Neoplasms Squamous Cell	Associate	25064463, 33568520, 33593111, 33687433, 34814915
Neoplastic Cells Circulating	Associate	37569332
Neoplastic Syndromes Hereditary	Associate	24380766
Nephritis	Associate	16367998, 34783463, 9150474
Nephritis Interstitial	Stimulate	17361117
Nephritis Interstitial	Associate	18300128, 36648741
Nephrogenic Fibrosing Dermopathy	Associate	15334482
Nephrotic Syndrome	Associate	11786088, 20446778
Nephrotic Syndrome	Stimulate	20446793
Nerve Compression Syndromes	Stimulate	39513613
Nerve Degeneration	Associate	24551286, 32945489, 34767750
Nervous System Diseases	Associate	17653872
Netherton Syndrome	Stimulate	19693466
Neuralgia	Associate	12928636
Neuroblastoma	Associate	10735501, 16412560, 22382496, 24158598, 27322426, 28393230, 33252831, 33619241, 8380955
Neurodegenerative Diseases	Associate	15895394, 26867675, 31081340, 32197075
Neuroectodermal Tumors	Associate	8200640
Neuroectodermal Tumors Primitive	Associate	8200640
Neuroendocrine Tumors	Associate	18567806, 35739266, 36653904
Neuroendocrine Tumors	Stimulate	39682758
Neurofibroma Plexiform	Stimulate	21703400, 37140985
Neurogenic Inflammation	Associate	33541932
Neuroinflammatory Diseases	Associate	16496359, 18326816, 33955515
Neuroinflammatory Diseases	Stimulate	31081340
Neuroinflammatory Diseases	Inhibit	38139158
Neurologic Manifestations	Associate	26867675, 28794441
Neuromuscular Diseases	Associate	32154989
Neurotoxicity Syndromes	Associate	11461976
Neurotoxicity Syndromes	Stimulate	2007861
Neutrophil Immunodeficiency Syndrome	Associate	34344357
Nevus	Associate	8669474
Nevus Pigmented	Associate	8669474
Nevus Sebaceous of Jadassohn	Associate	36552777
Niemann Pick Disease Type C	Associate	24367666
NOG Related Symphalangism Spectrum Disorder	Associate	10333714
Non alcoholic Fatty Liver Disease	Associate	19330863, 26001595, 31187872, 37415134, 38171883
Non alcoholic Fatty Liver Disease	Inhibit	31087761
Non Muscle Invasive Bladder Neoplasms	Associate	31735557, 34152439, 37452272
Nonsyndromic Holoprosencephaly	Associate	34496240
Noonan Syndrome	Stimulate	32493428
Norrie disease	Associate	24927876
Nose Diseases	Associate	1569205, 34953475
Nystagmus Pathologic	Associate	34916229
O'Donnell Pappas syndrome	Associate	12928636, 38634365
Obesity	Associate	19763090, 19822955, 23404842, 26147062, 27442659, 27651382, 28542577, 29115082, 32849611, 32968152, 35631263, 36232337, 37286588, 39272990
Obesity	Stimulate	23857381, 25086906, 27320704
Obesity	Inhibit	34445187
Obesity Metabolically Benign	Associate	35685490, 37286588
Oculocutaneous albinism type 2	Associate	29339669
Odontogenic Cysts	Associate	27279422, 9208810
Odontogenic Tumors	Associate	25879017
Oliver Syndrome	Associate	25759826
Oncocytoma renal	Associate	24704995
Oncogene Addiction	Associate	21555587, 35773268
Opioid Related Disorders	Associate	30071446
Optic Nerve Diseases	Associate	22126795
Oral Submucous Fibrosis	Associate	20930355, 22926483, 23284772, 26107172, 26922429, 30884781, 33191095, 38554333
Organizing Pneumonia	Associate	10725360
Orofacial Cleft 1	Associate	15212689
Oropharyngeal Neoplasms	Associate	20179236, 25273091, 29463556, 29663347
Ossification of Posterior Longitudinal Ligament	Associate	23479171
Osteoarthritis	Associate	10343777, 16542493, 16757188, 17156456, 1747946, 17827158, 18495502, 19036616, 19404930, 19890996, 20517696, 20833252, 22479506, 22653295, 22688823 View all (33 more)
Osteoarthritis	Inhibit	19852794, 24034904
Osteoarthritis	Stimulate	22127703, 22662110, 34440671
Osteoarthritis Hip	Associate	22820497, 23597094, 28860542
Osteoarthritis Knee	Associate	23597094, 26068512, 28627979, 29145839, 31077183, 32783329
Osteoarthropathy Primary Hypertrophic	Stimulate	21963742
Osteochondritis	Associate	29033566
Osteogenesis Imperfecta	Stimulate	33410269
Osteogenesis Imperfecta	Associate	35113812
Osteolysis	Associate	10975922, 11701443, 35798734
Osteomalacia	Associate	21541994
Osteonecrosis	Associate	17579298, 22975999
Osteopenic Nonfracture Syndrome	Associate	9783545
Osteophyte	Associate	10693888
Osteopoikilosis	Associate	27267960
Osteoporosis	Associate	10693888, 10750555, 10780855, 17059371, 21200384, 28420501, 29532880, 29745905, 31081069, 32080087, 34207210, 35937796, 36443839, 36578954, 38169377, 38509680, 9783545 View all (2 more)
Osteoporotic Fractures	Associate	10780855, 17059371, 34207210, 9783545
Osteoporotic Fractures	Inhibit	40065254
Osteoradionecrosis	Associate	21726429
Osteosarcoma	Associate	16540432, 22868198, 25562163, 25663491, 25912577, 26276504, 27532429, 30779063, 31251735, 31337976, 32751693, 35806417, 36519392, 37935976, 37940978, 37993664, 38071381, 39608425, 9605020 View all (4 more)
Osteosarcoma	Stimulate	8444890
Otitis Media	Associate	23133572, 24499112
Otosclerosis	Associate	23703862, 25569361, 27404893, 29728750, 35418358
Ovarian Diseases	Associate	18505915, 21156726, 21540640, 21799915, 24452274, 29987422, 32789750, 37008951
Ovarian Hyperstimulation Syndrome	Associate	31996061, 32152452
Ovarian Hyperstimulation Syndrome	Stimulate	32152452
Ovarian Neoplasms	Associate	12496270, 12743121, 14676209, 14715418, 15498571, 1586592, 16002410, 17579858, 18714391, 19755996, 20460476, 20508647, 20699661, 20797318, 21156726 View all (62 more)
Ovarian Neoplasms	Stimulate	18505915, 29130097, 31435668
Overweight	Associate	23597094, 26147062, 29115082, 32498337
Pain	Associate	19654961, 30690794, 36277021, 37454049
Pancreatic Carcinoma	Associate	25409617
Pancreatic Neoplasms	Associate	10433946, 12140283, 12379307, 15365564, 15855639, 15970678, 16086840, 16094523, 16135802, 16519564, 17114344, 17638924, 18157915, 18239055, 18310076 View all (72 more)
Pancreatic Neoplasms	Stimulate	16127427, 37455016
Pancreatic Neoplasms	Inhibit	34857888
Pancreatitis	Stimulate	16127427
Pancreatitis	Associate	16519564, 16680157, 17400536, 17638924, 26915435, 27473228, 37604222
Pancreatitis Acute Necrotizing	Associate	9445116
Pancreatitis Chronic	Stimulate	10400038, 16127427, 18053242, 19030200, 25278706, 30680957, 33893003
Pancreatitis Chronic	Associate	16127431, 16680157, 17400536, 26226105, 37604222
Pancreatitis Graft	Associate	21384510
Papilloma	Associate	35350785, 36154611
Papillomavirus Infections	Associate	27783717, 36611878
Papillomavirus Infections	Stimulate	36425786
Paracoccidioidomycosis	Associate	20643858
Paraparesis Tropical Spastic	Associate	18326816, 30466392
Paraproteinemias	Associate	18761817, 29589834
Parasitic Diseases	Associate	15951536
Parkinson Disease	Associate	31085228
Pathological Conditions Anatomical	Associate	32443848
Pdgfra Associated Chronic Eosinophilic Leukemia	Associate	34445093
pediatric multisystem inflammatory disease COVID 19 related	Associate	37255317
Pelvic Inflammatory Disease	Associate	35246120
Pelvic Organ Prolapse	Inhibit	28656271
Pelvic Organ Prolapse	Associate	29737911, 34176919, 37047060, 38488886
Pelvic Pain	Associate	32668141
Pemphigoid Bullous	Stimulate	1401998, 24945093
Pemphigoid Bullous	Associate	35140724
Penile Induration	Associate	18778497, 20367772, 20384945, 23770939, 24294365, 25532569, 37753943
Penile Neoplasms	Stimulate	37763742
Peri Implantitis	Associate	14607563
Periapical Diseases	Associate	28362997, 28678970, 31664358, 35360476, 40217194
Periapical Granuloma	Associate	28362997, 28678970, 40217194
Periapical Periodontitis	Associate	29898177, 35360476
Perinatal Death	Associate	17653872
Periodic fever familial autosomal dominant	Associate	31009059
Periodontal Diseases	Associate	17100776, 22395513
Periodontitis	Associate	16542362, 31118359, 31978095
Periodontitis	Stimulate	25040058, 34597477
Peripheral Arterial Disease	Associate	26847457, 32835907, 36300658
Peripheral Arterial Disease	Stimulate	34601016
Peripheral Arterial Occlusive Disease 1	Associate	19394554
Peripheral Vascular Diseases	Associate	15200451
Peritoneal Diseases	Associate	32823722
Peritoneal Fibrosis	Associate	18663255
Peritoneal Fibrosis	Stimulate	21034459, 25384022
Peritonitis	Associate	23760290, 33508890, 37989866
Persistent Infection	Stimulate	29093082, 33421993
Personality Disorders	Associate	25824321, 27581744, 28274951, 36207615
Personality Disorders	Stimulate	26520789
Phenylketonurias	Associate	36312597
Photosensitivity Disorders	Inhibit	21235789
Phyllodes Tumor	Stimulate	22203494
Pituitary Neoplasms	Associate	10079254, 10595920, 24636138, 30609812, 31109334, 9250163
Plagiocephaly and X linked mental retardation	Associate	24193348
Plaque Amyloid	Associate	12082048
Plasminogen Activator Inhibitor 1 Deficiency	Associate	33439236
Platelet Disorder Familial with Associated Myeloid Malignancy	Associate	33569577
Pleural Diseases	Associate	24142982
Pleural Effusion Malignant	Inhibit	26022333
Pneumonia	Associate	22924849, 26112417, 34643152, 37459093
Pneumonia Mycoplasma	Stimulate	29849498
Pneumothorax	Associate	27905298
Poikiloderma of Kindler	Associate	14634021
Polycystic Kidney Autosomal Dominant	Associate	19259356, 22174924
Polycystic Kidney Autosomal Recessive	Associate	34686668
Polycystic liver disease	Associate	37703354
Polycystic Ovary Syndrome	Associate	20630504, 22904171, 27796807, 28004769, 31287539, 31745224, 32454906, 33228780, 34480296, 35551681, 35760527, 35938797, 38166771, 39773546
Polycythemia Vera	Associate	35427808
Polymyositis	Associate	19364061
Polyposis Syndrome Hereditary Mixed 1	Associate	19462508
Polyps	Associate	1569205
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	16365456
Post Acute COVID 19 Syndrome	Associate	35008594, 35844548
Posterior Leukoencephalopathy Syndrome	Associate	29483653
postintensive care syndrome	Associate	25516419
Pre Eclampsia	Associate	17653872, 18156205, 19407822, 23437230, 25879409, 26010865, 26173679, 26515425, 27375191, 28347715, 28774740, 30579870, 31154903, 32432770, 35867736, 37950229, 39885406 View all (2 more)
Precancerous Conditions	Associate	22539603, 23706820, 26919310, 28061442
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	39658797
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	19406988
Preeclamptic toxemia	Associate	27375191, 36006052
Preeclamptic toxemia	Stimulate	30579870
Priapism	Associate	17408468
Primary Graft Dysfunction	Stimulate	26461171
Primary Myelofibrosis	Associate	18349123, 23403314, 30259659, 30539968, 31678370, 35439167, 36416374, 37439808, 38602559, 8977245
Primary Myelofibrosis	Stimulate	9163611
Prion Diseases	Associate	36581683
Propping Zerres syndrome	Associate	36672844
Prostatic Hyperplasia	Associate	12920242, 18619832, 19196965, 24311892, 24650126, 27243216, 28735516, 31694982, 33031138, 9477191
Prostatic Neoplasms	Associate	11248024, 12771931, 12841684, 15895377, 16203993, 16388503, 16397262, 17878531, 18507013, 18619832, 20019190, 20082326, 21030067, 21267466, 21876965 View all (60 more)
Prostatic Neoplasms	Inhibit	17579118
Prostatic Neoplasms Castration Resistant	Associate	23319273, 25520106, 37476073, 37729607
Prostatitis	Associate	10801443, 12841684, 16428382, 21030067, 21876965, 22791812, 25333263, 26181434, 28622443, 29699590, 31247718, 35672281
Protein Energy Malnutrition	Associate	38017491
Protein Losing Enteropathies	Associate	28557134
Proteinuria	Associate	15906952, 17622313, 18300128, 18676351, 34194427
Proteinuria	Stimulate	38401467
Pseudomonas Infections	Associate	21337732, 35525938
Pseudomyxoma Peritonei	Associate	28426742
Psoriasis	Inhibit	35848967
Psychological Distress	Associate	11060295
Pterygium	Associate	27530865, 32218695, 32867783, 37866886
Pulmonary Arterial Hypertension	Associate	18496036, 20081107, 20190034, 22198906, 23937428, 26801773, 30274147, 32813135
Pulmonary Atelectasis	Associate	35487970
Pulmonary Disease Chronic Obstructive	Associate	14514521, 14760152, 16227324, 16365456, 16456143, 16707515, 16780585, 17071067, 18670143, 19087346, 19186046, 19245428, 19797132, 19811381, 20459817 View all (44 more)
Pulmonary Disease Chronic Obstructive	Stimulate	19186046, 21908588, 22440430, 26375445, 34210319
Pulmonary Disease Chronic Obstructive	Inhibit	29289685, 34079246, 36277008
Pulmonary Emphysema	Associate	12746043, 28254114
Pulmonary Eosinophilia	Stimulate	31012597
Pulmonary Fibrosis	Associate	11290559, 11413354, 16365456, 1862087, 21625455, 23950911, 24574232, 24669910, 24958208, 26088859, 27107963, 28128990, 29207055, 30155985, 31085559 View all (13 more)
Pulmonary Fibrosis	Stimulate	25226160, 33361096, 37822112
Pulmonary Heart Disease	Associate	10817792
Purpura Thrombocytopenic Idiopathic	Stimulate	10477725
Purpura Thrombocytopenic Idiopathic	Associate	12176899, 14670926, 21591983, 24338252, 24801815, 30403287
Purpura Thrombocytopenic Idiopathic	Inhibit	31651870
Pyruvate Carboxylase Deficiency Disease	Associate	35197444
Pyruvate Carboxylase Deficiency Disease	Stimulate	35844548
Q Fever	Stimulate	8926081
Radiation Fibrosis Syndrome	Associate	30027292
Radiation Injuries	Associate	18400984, 23334061, 23697595
Radiation Injuries	Stimulate	29275310
Radiation Pneumonitis	Associate	19380441, 20193119, 22541966, 23059779, 28574846, 32252552
Radicular Cyst	Associate	28362997, 28678970, 40217194
Rectal Diseases	Associate	37387515
Rectal Neoplasms	Associate	16397240, 21365634, 22850566, 28333014, 29956755, 34366323, 37387515
Recurrent respiratory papillomatosis	Associate	35350785, 36154611
Renal Artery Obstruction	Stimulate	23258796
Renal cell carcinoma 1	Associate	31205451, 34853077
Renal Insufficiency	Associate	12911563, 14531781, 17428349, 19768163, 25724035, 30606202, 33069430, 9507209
Renal Insufficiency Chronic	Associate	12790768, 12911160, 15086490, 15910291, 16686760, 17361117, 17428349, 17622313, 22442213, 25587706, 32354559, 32626757, 33069430, 34614499, 35177746 View all (5 more)
Renal Insufficiency Chronic	Stimulate	16612332, 25782922
Respiratory Distress Syndrome	Associate	26088859, 34556700
Respiratory Distress Syndrome Newborn	Associate	29077160
Respiratory Insufficiency	Associate	23950911, 40273689
Respiratory Sounds	Associate	28284979
Respiratory Syncytial Virus Infections	Associate	21849067
Respiratory Tract Diseases	Associate	26542979, 33552042
Respiratory Tract Infections	Associate	25803862, 32567428
Retinal Arterial Macroaneurysm	Associate	29046343
Retinal Detachment	Associate	16704689
Retinal Dysplasia	Associate	23188426, 28314256
Retinal Perforations	Stimulate	19255163
Retinal Vein Occlusion	Inhibit	35808901
Retinal Vein Occlusion	Associate	36180575
Retinitis	Associate	21853110, 27112176
Retinitis Pigmentosa	Stimulate	24075003
Retinoblastoma	Associate	19001221
Retinoblastoma	Inhibit	8641969
Rhabdomyosarcoma	Associate	12974945, 20219075, 25806826, 8380955
Rheumatic Diseases	Associate	31861245
Rheumatic Heart Disease	Associate	18303197, 20235205, 28323847, 30697920
Rhinitis Allergic	Associate	1569205, 18201469, 22201619, 23884466, 33596578, 34445093, 35190755, 36032502
Rhinitis Allergic	Inhibit	24830974, 26546895
Rhinitis Allergic	Stimulate	26708394
Rotator Cuff Injuries	Associate	11565192, 31444797
Rotator Cuff Injuries	Inhibit	31444797
Salivary Gland Diseases	Associate	9038756
Salivary Gland Neoplasms	Associate	10879745
Sarcoidosis	Associate	21148227, 22209793, 26445225
Sarcoma	Associate	18506556, 36005179
Sarcoma Ewing	Associate	28030800, 29328472, 35739280
Sarcoma Ewing	Stimulate	37993664
Sarcoma Kaposi	Associate	15855173, 27208691, 9057628
Sarcoma Synovial	Associate	24294365, 28829837, 29020987, 35151264
Sarcoma Synovial	Stimulate	34853077
Schimke immunoosseous dysplasia	Associate	22699664, 25849153
Schizophrenia	Associate	24702465, 30468562, 36632818
Schizophrenia	Inhibit	24984193
Schmid Fraccaro syndrome	Associate	37599366
Scleroderma Diffuse	Associate	19812599, 28681919, 29858547, 37580109
Scleroderma Localized	Associate	2307855
Scleroderma Systemic	Associate	10809757, 11710721, 12428243, 12905481, 17907149, 19536281, 20190732, 21569507, 24574232, 26357964, 26360820, 27054717, 28298564, 29616048, 30075746 View all (8 more)
Scleromyxedema	Stimulate	32027747
Sclerosis	Associate	11278244, 18676351
Scoliosis	Associate	30079294, 31827250
Segmentation syndrome 1	Associate	33428109
Seizures Febrile	Associate	26076859
Sertoli Cell Only Syndrome	Associate	21126344
SeSAME syndrome	Associate	14633126
Severe Acute Respiratory Syndrome	Associate	18314161, 38375886
Severe Acute Respiratory Syndrome	Stimulate	36834879
Sexual Dysfunction Physiological	Stimulate	24310606
Short Bowel Syndrome	Associate	28333014
Shprintzen Golberg craniosynostosis	Associate	31391415, 33416497, 34916229
Shwachman Diamond Syndrome	Associate	31039138, 31211692
Sick Sinus Syndrome	Associate	27380173
Silicosis	Associate	36350953
Sjogren's Syndrome	Associate	12560464, 14872501, 15027908, 27142093, 30598637, 31925325, 35705251, 36999025, 9038756, 9867125
Skin Diseases	Stimulate	15908402
Skin Diseases	Associate	29858547, 36672844, 7636314
Skin Neoplasms	Associate	22002724, 35886018
Sleep Apnea Obstructive	Associate	20847078, 28619958, 34239024, 34916229, 36265878
Sleep Apnea Obstructive	Inhibit	32380702
Sleep Apnea Obstructive	Stimulate	32968152
Sleep Deprivation	Stimulate	14747535
Sleep Deprivation	Associate	33568351
Sleep Wake Disorders	Stimulate	24115141
Small Cell Lung Carcinoma	Associate	10098728, 26823791, 31113982, 32764738, 35838343, 40022030, 8388229, 8624260
Small Cell Lung Carcinoma	Inhibit	8180008
Smith McCort Dysplasia	Associate	20020816, 34638875
Smoke Inhalation Injury	Associate	22513132
smoker's inclusion bodies	Stimulate	22440430
Smooth Muscle Tumor	Stimulate	17468136
Soft Tissue Injuries	Associate	22355352, 22924849, 27566553, 28679693, 34105356
Spheroid body myopathy	Associate	27622654
Spinal Cord Injuries	Associate	36959678
Spinal Dysraphism	Associate	35505001
Spinal Osteophytosis	Associate	10693888
Spondylitis	Associate	37371064
Spondylitis Ankylosing	Associate	16180249, 38634365
Spondylitis Ankylosing	Stimulate	33410269
Spondylocarpotarsal synostosis	Associate	28205584
Spondylocostal dysostosis autosomal recessive	Associate	9783545
Spondyloepimetaphyseal Dysplasia X Linked	Associate	39940902
Squamous Cell Carcinoma of Head and Neck	Associate	12373600, 15161003, 15247230, 16478646, 17217620, 18234959, 18472963, 22641218, 23370231, 24278120, 2478181, 25064463, 25130698, 25240937, 25275298 View all (35 more)
Squamous Cell Carcinoma of Head and Neck	Stimulate	21264308, 21442435, 27567435, 34847839
ST Elevation Myocardial Infarction	Associate	26188123
Status Asthmaticus	Associate	10955758, 11298190, 15466377, 17468136, 19043669, 20705942, 21131394, 21802932, 23496774, 23563034, 24669775, 24782592, 25697361, 26342086, 27627560 View all (7 more)
Status Asthmaticus	Stimulate	21864337, 22573806, 22814516, 23857381, 24349168, 27297409, 31665016, 32155894
Status Asthmaticus	Inhibit	27221564
Stiff Skin Syndrome	Associate	25979247, 36632818
Stomach Diseases	Associate	14595120, 34104107, 7493912
Stomach Neoplasms	Associate	10376964, 10839293, 11543663, 12353499, 12971256, 1312080, 1386559, 14669355, 15033661, 15609398, 16055706, 16101328, 16987993, 17601708, 18328430 View all (88 more)
Stomach Neoplasms	Stimulate	20529313, 30226558, 30255106
Stomach Ulcer	Associate	15609413
Strabismus	Associate	34916229
Stress Disorders Post Traumatic	Associate	22464821
Stroke	Associate	15778708, 26867675
Subarachnoid Hemorrhage	Associate	26198819, 26675167
Supranuclear Palsy Progressive	Associate	21741294
Sutton disease 2	Associate	29307155, 35660731
Sveinsson Chorioretinal Atrophy	Associate	34244757
Syndrome	Stimulate	23028541
Syndrome	Associate	26345917
Synovial Cyst	Associate	1747946
Systemic Inflammatory Response Syndrome	Associate	16278000, 33510953
Systemic Inflammatory Response Syndrome	Stimulate	27165859
Systemic Vasculitis	Associate	20037209
Systemic Vasculitis	Stimulate	8697616
Tachycardia	Associate	35315241
Tachycardia Atrioventricular Nodal Reentry	Associate	16101174, 9823982
Tachycardia Sinoatrial Nodal Reentry	Stimulate	34737220
Telangiectasia Hereditary Hemorrhagic	Associate	15994879, 21967607, 22310796, 22553411, 23772771, 24098321, 24603890, 29932521, 35343049, 35456471
Telangiectasis	Associate	17325707, 19744994
Temporomandibular Joint Disorders	Inhibit	22000099
Temporomandibular Joint Disorders	Associate	34916229, 39933558
Tendinopathy	Associate	29385715, 31444797
Tertiary Lymphoid Structures	Associate	12174377, 22103462, 29749506, 8198961
Tertiary Lymphoid Structures	Stimulate	17242701, 29320969
Testicular Diseases	Associate	21126344
Tetralogy of Fallot	Associate	23032507
Thoracic Diseases	Associate	23334061, 37042257
Thrombocythemia Essential	Stimulate	15682418
Thrombocytopenia	Associate	10606887
Thrombophlebitis	Stimulate	21478096
Thrombosis	Associate	16931622
Thymic epithelial tumor	Associate	30168897
Thymoma	Stimulate	30168897
Thymoma	Associate	30787364
Thyroid Cancer Papillary	Associate	17003485, 17296934, 23591524, 23918305, 26264613, 26687649, 27345036, 30042377, 33905626, 35871446
Thyroid Cancer Papillary	Stimulate	25927212, 33905626
Thyroid Cancer Papillary	Inhibit	35118633
Thyroid Carcinoma Anaplastic	Associate	30171257
Thyroid Diseases	Associate	29131274
Thyroid Neoplasms	Associate	25927212, 26678064, 27507052, 28393241, 30171257, 32337286, 32698816, 35118633
Thyroid Neoplasms	Stimulate	26406959
Thyroid Nodule	Associate	19138047, 25927212, 33905626
Thyroiditis Autoimmune	Associate	18190611, 27345036, 36834770
Tibial Meniscus Injuries	Associate	25418724
Tissue Adhesions	Stimulate	26719893
Tissue Adhesions	Associate	28531361
Tongue Neoplasms	Associate	25130698
Tonsillitis	Associate	27058240
Tooth Erosion	Associate	21740541
Tooth Injuries	Associate	28779848
Trichuriasis	Associate	28284979
Tricuspid Valve Stenosis	Associate	21448509
Triple Negative Breast Neoplasms	Associate	23049873, 25824321, 28674186, 28754615, 29362917, 30004628, 32196606, 32303620, 32357907, 33294922, 33461373, 33674749, 34299315, 34326372, 34481843 View all (6 more)
Triple Negative Breast Neoplasms	Inhibit	26703884
Triple Negative Breast Neoplasms	Stimulate	39206896
Tuberculosis	Associate	12751024, 16556259, 21303360, 26073153, 32296431, 35969076, 36348467, 37460564, 8622912
Tuberculosis	Stimulate	15102771, 23486418, 33841412
Tuberculosis Multidrug Resistant	Associate	27681197
Tuberculosis Osteoarticular	Stimulate	28543876
Tuberculosis Pulmonary	Associate	16840026, 31756428, 33202583
Turcot syndrome	Associate	32493700, 32620917
Ureteral Obstruction	Associate	10594789
Urethral Neoplasms	Associate	32182655
Urinary Bladder Diseases	Associate	16367920
Urinary Bladder Neck Obstruction	Associate	28138557
Urinary Bladder Neoplasms	Associate	16412233, 18311384, 23251617, 24078506, 25722217, 25928257, 26152796, 26684800, 26784156, 26988652, 28081738, 29312460, 29321082, 29349903, 29636362 View all (17 more)
Urinary Bladder Neoplasms	Inhibit	25132950, 9192977
Urinary Bladder Neurogenic	Stimulate	35662268
Urinary Incontinence Stress	Inhibit	31059065
Urinary Incontinence Stress	Associate	33836021
Urinary Retention	Associate	8567993
Urogenital Diseases	Associate	36494413
Uropathy distal obstructive polydactyly	Stimulate	37752256
Uterine Cervical Dysplasia	Stimulate	8088612
Uterine Cervical Neoplasms	Associate	11509647, 19344999, 20565840, 23587428, 23873179, 24047375, 25273091, 25786122, 26769181, 27220278, 27721577, 27916907, 28446743, 28906311, 29180690 View all (18 more)
Uterine Cervical Neoplasms	Inhibit	15047811
Uterine Cervical Neoplasms	Stimulate	2168964
Uterine Cervicitis	Stimulate	22542711
Uterine Cervicitis	Associate	25372418, 31351582, 36611878
Uterine Diseases	Associate	33313721
Uveitis	Associate	10469047
Uveomeningoencephalitic Syndrome	Associate	20591073
Varicocele	Associate	37916368
Varicose Ulcer	Associate	11710945, 20069132, 31674093
Varicose Ulcer	Stimulate	27994710
Varicose Veins	Associate	15838489, 21478096, 37916368
Varicose Veins	Stimulate	33482378
Vascular Calcification	Associate	35440618, 36787443
Vascular Diseases	Associate	12457461, 15200451, 20368328, 28258189, 28628273, 40240926
Vascular Diseases	Stimulate	8675633
Vascular System Injuries	Associate	1328302
Vasculitis Lymphocytic Cutaneous Small Vessel	Associate	25862016
Venous Insufficiency	Associate	11700497, 19560950, 31886225
Venous Thrombosis	Associate	35808901
Ventricular Dysfunction Left	Associate	15049387, 22136666, 32108968, 36632818
Ventricular Dysfunction Left	Stimulate	21126621
Ventricular Fibrillation	Associate	15086490
Ventricular Remodeling	Associate	17251317, 20214667, 23583823, 23871585, 25298166, 27126693, 30971721, 30984775, 34946964, 38290462, 39457420
Vesico Ureteral Reflux	Associate	15086490, 22558067
Virus Diseases	Associate	18092051, 21424084, 22915806, 26795696
Virus Diseases	Stimulate	28046097
Vitiligo	Inhibit	26370050
Vitiligo	Associate	29974998
Vitreoretinopathy Proliferative	Associate	16704689, 21858467, 22550395, 24607896, 28625142, 31069271, 32638535, 34032608, 36494806, 39486365
Vocal Cord Paralysis	Associate	35793946
Vulvar Neoplasms	Associate	9067409
White Dot Syndromes	Associate	31700227
Wilms Tumor	Associate	31035970, 7656270, 9223327
Wounds and Injuries	Stimulate	11224628, 30601836, 33439236, 37161592
Wounds and Injuries	Associate	11710945, 30372878, 36835007, 8889469
X Linked Combined Immunodeficiency Diseases	Associate	20389311
X linked sideroblastic anemia	Associate	19036111
Yellow Fever	Associate	16278000
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Inhibit	34302427

TGFB1 (transforming growth factor beta 1)