Gene Gene information from NCBI Gene database.
Entrez ID 7039
Gene name Transforming growth factor alpha
Gene symbol TGFA
Synonyms (NCBI Gene)
TFGA
Chromosome 2
Chromosome location 2p13.3
Summary This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a solu
miRNA miRNA information provided by mirtarbase database.
345
miRTarBase ID miRNA Experiments Reference
MIRT035552 hsa-miR-152-3p Luciferase reporter assay 23460133
MIRT035552 hsa-miR-152-3p Luciferase reporter assay 23460133
MIRT049451 hsa-miR-92a-3p CLASH 23622248
MIRT437890 hsa-miR-376c-3p Luciferase reporter assayWestern blot 23631646
MIRT437890 hsa-miR-376c-3p Luciferase reporter assayWestern blot 23631646
Transcription factors Transcription factors information provided by TRRUST V2 database.
5
Transcription factor Regulation Reference
AR Activation 11556855
ESR1 Activation 11517191
ESR1 Unknown 10828826
ESR2 Activation 11517191
SP1 Unknown 10828826
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
44
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0005102 Function Signaling receptor binding IEA
GO:0005154 Function Epidermal growth factor receptor binding IBA
GO:0005154 Function Epidermal growth factor receptor binding IDA 6315706, 11278323
GO:0005515 Function Protein binding IPI 12297049, 15064403, 15652357, 18757723, 24658140, 25416956, 28988771, 31980649, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
190170 11765 ENSG00000163235
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P01135
Protein name Protransforming growth factor alpha [Cleaved into: Transforming growth factor alpha (TGF-alpha) (EGF-like TGF) (ETGF) (TGF type 1)]
Protein function TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
PDB 1GK5 , 1MOX , 1YUF , 1YUG , 2TGF , 3E50 , 3TGF , 4TGF , 5KN5 , 7SZ5 , 7SZ7
Family and domains
Tissue specificity TISSUE SPECIFICITY: Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines. {ECO:0000269|PubMed:10523832}.
Sequence
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Sequence length 160
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Estrogen signaling pathway
Pathways in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Glioma
Prostate cancer
Non-small cell lung cancer
Hepatocellular carcinoma
  PIP3 activates AKT signaling
Signaling by EGFR
GRB2 events in EGFR signaling
GAB1 signalosome
SHC1 events in EGFR signaling
EGFR downregulation
COPII-mediated vesicle transport
EGFR interacts with phospholipase C-gamma
Constitutive Signaling by Aberrant PI3K in Cancer
Inhibition of Signaling by Overexpressed EGFR
RAF/MAP kinase cascade
Cargo concentration in the ER
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
TFAP2 (AP-2) family regulates transcription of growth factors and their receptors
Extra-nuclear estrogen signaling
Estrogen-dependent gene expression
Estrogen-dependent nuclear events downstream of ESR-membrane signaling
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Benign rs11466221 RCV005904570
Uterine corpus endometrial carcinoma Benign rs11466221 RCV005904571
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acanthosis Nigricans Associate 3279155
Adenocarcinoma Associate 17647268, 36928883
Adenocarcinoma Stimulate 8097369
Adenocarcinoma of Lung Associate 27207663
Adenoma Stimulate 1519669
Aneuploidy Associate 10861689
Anodontia Associate 18790474, 29893310
Arthritis Psoriatic Associate 1512472, 8064230
Arthritis Psoriatic Stimulate 2476168
Asthma Stimulate 38253462