Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7039
Gene name Gene Name - the full gene name approved by the HGNC.
Transforming growth factor alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TGFA
Synonyms (NCBI Gene) Gene synonyms aliases
TFGA
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a solu
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT035552 hsa-miR-152-3p Luciferase reporter assay 23460133
MIRT035552 hsa-miR-152-3p Luciferase reporter assay 23460133
MIRT049451 hsa-miR-92a-3p CLASH 23622248
MIRT437890 hsa-miR-376c-3p Luciferase reporter assay, Western blot 23631646
MIRT437890 hsa-miR-376c-3p Luciferase reporter assay, Western blot 23631646
Transcription factors
Transcription factor Regulation Reference
AR Activation 11556855
ESR1 Activation 11517191
ESR1 Unknown 10828826
ESR2 Activation 11517191
SP1 Unknown 10828826
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0005102 Function Signaling receptor binding IEA
GO:0005154 Function Epidermal growth factor receptor binding IBA
GO:0005154 Function Epidermal growth factor receptor binding IDA 6315706, 11278323
GO:0005515 Function Protein binding IPI 12297049, 15064403, 15652357, 18757723, 24658140, 25416956, 28988771, 31980649, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
190170 11765 ENSG00000163235
Protein
UniProt ID P01135
Protein name Protransforming growth factor alpha [Cleaved into: Transforming growth factor alpha (TGF-alpha) (EGF-like TGF) (ETGF) (TGF type 1)]
Protein function TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
PDB 1GK5 , 1MOX , 1YUF , 1YUG , 2TGF , 3E50 , 3TGF , 4TGF , 5KN5 , 7SZ5 , 7SZ7
Family and domains
Tissue specificity TISSUE SPECIFICITY: Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines. {ECO:0000269|PubMed:10523832}.
Sequence
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Sequence length 160
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Estrogen signaling pathway
Pathways in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Glioma
Prostate cancer
Non-small cell lung cancer
Hepatocellular carcinoma
  PIP3 activates AKT signaling
Signaling by EGFR
GRB2 events in EGFR signaling
GAB1 signalosome
SHC1 events in EGFR signaling
EGFR downregulation
COPII-mediated vesicle transport
EGFR interacts with phospholipase C-gamma
Constitutive Signaling by Aberrant PI3K in Cancer
Inhibition of Signaling by Overexpressed EGFR
RAF/MAP kinase cascade
Cargo concentration in the ER
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
TFAP2 (AP-2) family regulates transcription of growth factors and their receptors
Extra-nuclear estrogen signaling
Estrogen-dependent gene expression
Estrogen-dependent nuclear events downstream of ESR-membrane signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ischemic Stroke Ischemic stroke N/A N/A GWAS
Tooth Agenesis tooth agenesis N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acanthosis Nigricans Associate 3279155
Adenocarcinoma Associate 17647268, 36928883
Adenocarcinoma Stimulate 8097369
Adenocarcinoma of Lung Associate 27207663
Adenoma Stimulate 1519669
Aneuploidy Associate 10861689
Anodontia Associate 18790474, 29893310
Arthritis Psoriatic Associate 1512472, 8064230
Arthritis Psoriatic Stimulate 2476168
Asthma Stimulate 38253462