Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7036
Gene name Gene Name - the full gene name approved by the HGNC.
Transferrin receptor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TFR2
Synonyms (NCBI Gene) Gene synonyms aliases
HFE3, TFRC2
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a single-pass type II membrane protein, which is a member of the transferrin receptor-like family. This protein mediates cellular uptake of transferrin-bound iron, and may be involved in iron metabolism, hepatocyte function and erythrocy
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs41295912 G>A,C Conflicting-interpretations-of-pathogenicity, likely-benign Intron variant
rs41303495 G>T Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs41303501 C>T Benign, likely-benign, risk-factor Missense variant, coding sequence variant
rs80338876 C>T Pathogenic Missense variant, coding sequence variant, genic upstream transcript variant
rs80338877 ->G Pathogenic Coding sequence variant, genic upstream transcript variant, frameshift variant
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004998 Function Transferrin receptor activity IDA 18353247
GO:0004998 Function Transferrin receptor activity IEA
GO:0004998 Function Transferrin receptor activity NAS 10409623
GO:0005515 Function Protein binding IPI 18353247, 22728873, 25635054, 29388418, 32296183
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604720 11762 ENSG00000106327
Protein
UniProt ID Q9UP52
Protein name Transferrin receptor protein 2 (TfR2)
Protein function Mediates cellular uptake of transferrin-bound iron in a non-iron dependent manner. May be involved in iron metabolism, hepatocyte function and erythrocyte differentiation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02225 PA 241 329 PA domain Family
PF04389 Peptidase_M28 412 624 Peptidase family M28 Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in liver. While the alpha form is also expressed in spleen, lung, muscle, prostate and peripheral blood mononuclear cells, the beta form is expressed in all tissues tested, albeit weakly.
Sequence
MERLWGLFQRAQQLSPRSSQTVYQRVEGPRKGHLEEEEEDGEEGAETLAHFCPMELRGPE
PLGSRPRQPNLIPWAAAGRRAAPYLVLTALLIFTGAFLLGYVAFRGSCQACGDSVLVVSE
DVNYEPDLDFHQGRLYWSDLQAMFLQFLGEGRLEDTIRQTSLRERVAGSAGMAALTQDIR
AALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDPDVYCPYSAIGN
VTGELVYAHYGRPEDLQDLRARGVDPVGRLLLVRVGVISFAQKVTNAQDFGAQGVLIYPE
PADFSQDPPKPSLSSQQAVYGHVHLGTGD
PYTPGFPSFNQTQFPPVASSGLPSIPAQPIS
ADIASRLLRKLKGPVAPQEWQGSLLGSPYHLGPGPRLRLVVNNHRTSTPINNIFGCIEGR
SEPDHYVVIGAQRDAWGPGAAKSAVGTAILLELVRTFSSMVSNGFRPRRSLLFISWDGGD
FGSVGSTEWLEGYLSVLHLKAVVYVSLDNAVLGDDKFHAKTSPLLTSLIESVLKQVDSPN
HSGQTLYEQVVFTNPSWDAEVIRPLPMDSSAYSFTAFVGVPAVEFSFMEDDQAYPFLHTK
EDTYENLHKVLQGRLPAVAQAVAQ
LAGQLLIRLSHDRLLPLDFGRYGDVVLRHIGNLNEF
SGDLKARGLTLQWVYSARGDYIRAAEKLRQEIYSSEERDERLTRMYNVRIMRVEFYFLSQ
YVSPADSPFRHIFMGRGDHTLGALLDHLRLLRSNSSGTPGATSSTGFQESRFRRQLALLT
WTLQGAANALSGDVWNIDNNF
Sequence length 801
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  TGF-beta signaling pathway   Transferrin endocytosis and recycling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hemochromatosis hemochromatosis type 3 rs1051249273, rs1405776096, rs80338879, rs80338889, rs786204108, rs1803297757, rs80338882, rs773050231, rs80338883, rs946552921, rs1422733588, rs80338888, rs1220336558, rs768907730, rs80338891
View all (5 more)
N/A
Hereditary Hemochromatosis hereditary hemochromatosis rs786204108, rs1051249273, rs1803297757, rs1388444100, rs80338882, rs773050231, rs1584460907, rs749211542, rs946552921, rs1422733588, rs1426704853, rs1220336558, rs768907730, rs1803411479, rs80338888
View all (7 more)
N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or gastroesophageal reflux disease N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthralgia Associate 28276324
Arthritis Associate 15319290
Autism Spectrum Disorder Associate 31936202
beta Thalassemia Associate 35355750
Carcinoma Hepatocellular Associate 11675342, 17956864, 19828835, 20576915
Carcinoma Pancreatic Ductal Associate 34258619
Colorectal Neoplasms Associate 32375704
Crohn Disease Associate 40527798
Diabetes Mellitus Associate 15319290
Drug Related Side Effects and Adverse Reactions Associate 20220060