Gene Gene information from NCBI Gene database.
Entrez ID 7035
Gene name Tissue factor pathway inhibitor
Gene symbol TFPI
Synonyms (NCBI Gene)
EPILACITFITFPI1
Chromosome 2
Chromosome location 2q32.1
Summary This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates addit
miRNA miRNA information provided by mirtarbase database.
616
miRTarBase ID miRNA Experiments Reference
MIRT018341 hsa-miR-335-5p Microarray 18185580
MIRT020797 hsa-miR-155-5p Proteomics 18668040
MIRT021798 hsa-miR-132-3p Microarray 17612493
MIRT025882 hsa-miR-7-5p Microarray 17612493
MIRT025882 hsa-miR-7-5p Microarray 19073608
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0004866 Function Endopeptidase inhibitor activity TAS 9252393
GO:0004867 Function Serine-type endopeptidase inhibitor activity IBA
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
152310 11760 ENSG00000003436
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P10646
Protein name Tissue factor pathway inhibitor (TFPI) (Extrinsic pathway inhibitor) (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)
Protein function Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoprot
PDB 1ADZ , 1IRH , 1TFX , 4BQD , 4DTG , 5NMV , 6BX8 , 7V1N
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00014 Kunitz_BPTI 53 105 Kunitz/Bovine pancreatic trypsin inhibitor domain Domain
PF00014 Kunitz_BPTI 124 176 Kunitz/Bovine pancreatic trypsin inhibitor domain Domain
PF00014 Kunitz_BPTI 216 268 Kunitz/Bovine pancreatic trypsin inhibitor domain Domain
Tissue specificity TISSUE SPECIFICITY: Mostly in endothelial cells.
Sequence
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADD
GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCT
RDNANRIIKTTLQQE
KPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPN
GFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIG
KCRPFKYSGCGGNENNFTSKQECLRACK
KGFIQRISKGGLIKTKRKRKKQRVKIAYEEIF
VKNM
Sequence length 304
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Complement and coagulation cascades   Extrinsic Pathway of Fibrin Clot Formation