Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7035
Gene name Gene Name - the full gene name approved by the HGNC.
Tissue factor pathway inhibitor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TFPI
Synonyms (NCBI Gene) Gene synonyms aliases
EPI, LACI, TFI, TFPI1
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q32.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates addit
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018341 hsa-miR-335-5p Microarray 18185580
MIRT020797 hsa-miR-155-5p Proteomics 18668040
MIRT021798 hsa-miR-132-3p Microarray 17612493
MIRT025882 hsa-miR-7-5p Microarray 17612493
MIRT025882 hsa-miR-7-5p Microarray 19073608
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004866 Function Endopeptidase inhibitor activity TAS 9252393
GO:0004867 Function Serine-type endopeptidase inhibitor activity IBA
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
152310 11760 ENSG00000003436
Protein
UniProt ID P10646
Protein name Tissue factor pathway inhibitor (TFPI) (Extrinsic pathway inhibitor) (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)
Protein function Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoprot
PDB 1ADZ , 1IRH , 1TFX , 4BQD , 4DTG , 5NMV , 6BX8 , 7V1N
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00014 Kunitz_BPTI 53 105 Kunitz/Bovine pancreatic trypsin inhibitor domain Domain
PF00014 Kunitz_BPTI 124 176 Kunitz/Bovine pancreatic trypsin inhibitor domain Domain
PF00014 Kunitz_BPTI 216 268 Kunitz/Bovine pancreatic trypsin inhibitor domain Domain
Tissue specificity TISSUE SPECIFICITY: Mostly in endothelial cells.
Sequence
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADD
GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCT
RDNANRIIKTTLQQE
KPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPN
GFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIG
KCRPFKYSGCGGNENNFTSKQECLRACK
KGFIQRISKGGLIKTKRKRKKQRVKIAYEEIF
VKNM
Sequence length 304
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Complement and coagulation cascades   Extrinsic Pathway of Fibrin Clot Formation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Carcinoma Basal cell carcinoma N/A N/A GWAS
Coronary Heart Disease Coronary heart disease N/A N/A GWAS
Lung adenocarcinoma Lung adenocarcinoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Activated Protein C Resistance Associate 11703344, 21564075
Acute Coronary Syndrome Associate 14640893
Allergic Fungal Sinusitis Associate 35271862
Angina Unstable Stimulate 14640893
Atherosclerosis Associate 14522500, 19467658, 26826018, 28749986
Atrial Fibrillation Inhibit 28471981
Atrial Fibrillation Associate 36253349
Blood Coagulation Disorders Inhibit 10072106, 11380428, 21895962, 26826018, 28716011
Blood Coagulation Disorders Associate 18695356, 25042561, 28749986, 28894953, 35014954, 35271862, 36142345, 40629026, 8652818
Breast Neoplasms Associate 21849050, 23071754, 23320987, 25407022, 25617766, 25849335, 25882602, 26598923, 26999003, 26999742