Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7029
Gene name Gene Name - the full gene name approved by the HGNC.
Transcription factor Dp-2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TFDP2
Synonyms (NCBI Gene) Gene synonyms aliases
DP2
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q23
Summary Summary of gene provided in NCBI Entrez Gene.
The gene is a member of the transcription factor DP family. The encoded protein forms heterodimers with the E2F transcription factors resulting in transcriptional activation of cell cycle regulated genes. Alternative splicing results in multiple transcrip
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021648 hsa-miR-141-3p Western blot 20053927
MIRT708706 hsa-miR-4428 HITS-CLIP 19536157
MIRT708705 hsa-miR-6502-3p HITS-CLIP 19536157
MIRT708704 hsa-miR-4476 HITS-CLIP 19536157
MIRT708703 hsa-miR-6876-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000083 Process Regulation of transcription involved in G1/S transition of mitotic cell cycle TAS
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA 21873635
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 7739537, 9501179
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602160 11751 ENSG00000114126
Protein
UniProt ID Q14188
Protein name Transcription factor Dp-2 (E2F dimerization partner 2)
Protein function Can stimulate E2F-dependent transcription. Binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation
PDB 1CF7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02319 E2F_TDP 128 208 E2F/DP family winged-helix DNA-binding domain Domain
PF08781 DP 215 353 Transcription factor DP Domain
Tissue specificity TISSUE SPECIFICITY: High levels in heart and skeletal muscle. Also found in placenta, kidney, brain, lung and liver. The presence as well as the abundance of the different transcripts appear to vary significantly in different tissues and cell lines.
Sequence
MTAKNVGLTSTNAEVRGFIDQNLSPTKGNISFVAFPVSNTNSPTKILPKTLGPINVNVGP
QMIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKFIDSDFSESK
RSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNI
RRRVYDALNVLMAMNIISKEKKEIKWIG
LPTNSAQECQNLEIEKQRRIERIKQKRAQLQE
LLLQQIAFKNLVQRNRQNEQQNQGPPALNSTIQLPFIIINTSRKTVIDCSISSDKFEYLF
NFDNTFEIHDDIEVLKRMGMSFGLESGKCSLEDLKLAKSLVPKALEGYITDIS
TGPSWLN
QGLLLNSTQSVSNLDLTTGATLPQSSVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCS
ESRGETPCSFNDEDEEDDEEDSSSPE
Sequence length 446
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell cycle   Activation of NOXA and translocation to mitochondria
Transcription of E2F targets under negative control by DREAM complex
Activation of PUMA and translocation to mitochondria
G0 and Early G1
Pre-NOTCH Transcription and Translation
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
Oxidative Stress Induced Senescence
Oncogene Induced Senescence
TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
Cyclin E associated events during G1/S transition
G1/S-Specific Transcription
Cyclin D associated events in G1
Cyclin A:Cdk2-associated events at S phase entry
Transcriptional Regulation by E2F6
Transcriptional regulation of granulopoiesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Kidney disease Chronic Kidney Diseases rs74315342, rs749740335, rs757649673, rs112417755, rs35138315 20383146, 22479191
Renal carcinoma Renal Cell Carcinoma rs121913668, rs121913670, rs121913243, rs786202724 28598434
Unknown
Disease term Disease name Evidence References Source
Testicular Germ Cell Tumor Testicular Germ Cell Tumor GWAS
Kidney Disease Kidney Disease GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Gout Gout GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 29200198
Autoimmune Diseases Associate 21752305
Carcinoma Hepatocellular Stimulate 12679910
Carcinoma Papillary Associate 15619007
Colorectal Neoplasms Associate 2123114
COVID 19 Stimulate 33947851
Diabetes Gestational Inhibit 31923230
Disease Progression Associate 32077309
Eosinophilic Esophagitis Associate 30989466
Hypoxia Brain Associate 33947851