Gene Gene information from NCBI Gene database.
Entrez ID 7029
Gene name Transcription factor Dp-2
Gene symbol TFDP2
Synonyms (NCBI Gene)
DP2
Chromosome 3
Chromosome location 3q23
Summary The gene is a member of the transcription factor DP family. The encoded protein forms heterodimers with the E2F transcription factors resulting in transcriptional activation of cell cycle regulated genes. Alternative splicing results in multiple transcrip
miRNA miRNA information provided by mirtarbase database.
905
miRTarBase ID miRNA Experiments Reference
MIRT021648 hsa-miR-141-3p Western blot 20053927
MIRT708706 hsa-miR-4428 HITS-CLIP 19536157
MIRT708705 hsa-miR-6502-3p HITS-CLIP 19536157
MIRT708704 hsa-miR-4476 HITS-CLIP 19536157
MIRT708703 hsa-miR-6876-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 7739537, 9501179
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602160 11751 ENSG00000114126
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14188
Protein name Transcription factor Dp-2 (E2F dimerization partner 2)
Protein function Can stimulate E2F-dependent transcription. Binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation
PDB 1CF7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02319 E2F_TDP 128 208 E2F/DP family winged-helix DNA-binding domain Domain
PF08781 DP 215 353 Transcription factor DP Domain
Tissue specificity TISSUE SPECIFICITY: High levels in heart and skeletal muscle. Also found in placenta, kidney, brain, lung and liver. The presence as well as the abundance of the different transcripts appear to vary significantly in different tissues and cell lines.
Sequence
MTAKNVGLTSTNAEVRGFIDQNLSPTKGNISFVAFPVSNTNSPTKILPKTLGPINVNVGP
QMIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKFIDSDFSESK
RSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNI
RRRVYDALNVLMAMNIISKEKKEIKWIG
LPTNSAQECQNLEIEKQRRIERIKQKRAQLQE
LLLQQIAFKNLVQRNRQNEQQNQGPPALNSTIQLPFIIINTSRKTVIDCSISSDKFEYLF
NFDNTFEIHDDIEVLKRMGMSFGLESGKCSLEDLKLAKSLVPKALEGYITDIS
TGPSWLN
QGLLLNSTQSVSNLDLTTGATLPQSSVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCS
ESRGETPCSFNDEDEEDDEEDSSSPE
Sequence length 446
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell cycle   Activation of NOXA and translocation to mitochondria
Transcription of E2F targets under negative control by DREAM complex
Activation of PUMA and translocation to mitochondria
G0 and Early G1
Pre-NOTCH Transcription and Translation
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
Oxidative Stress Induced Senescence
Oncogene Induced Senescence
TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
Cyclin E associated events during G1/S transition
G1/S-Specific Transcription
Cyclin D associated events in G1
Cyclin A:Cdk2-associated events at S phase entry
Transcriptional Regulation by E2F6
Transcriptional regulation of granulopoiesis