Gene Gene information from NCBI Gene database.
Entrez ID 7027
Gene name Transcription factor Dp-1
Gene symbol TFDP1
Synonyms (NCBI Gene)
DILCDP1DRTF1Dp-1
Chromosome 13
Chromosome location 13q34
Summary This gene encodes a member of a family of transcription factors that heterodimerize with E2F proteins to enhance their DNA-binding activity and promote transcription from E2F target genes. The encoded protein functions as part of this complex to control t
miRNA miRNA information provided by mirtarbase database.
460
miRTarBase ID miRNA Experiments Reference
MIRT036682 hsa-miR-935 CLASH 23622248
MIRT067977 hsa-miR-30d-5p PAR-CLIP 20371350
MIRT067979 hsa-miR-30e-5p PAR-CLIP 20371350
MIRT067976 hsa-miR-30c-5p PAR-CLIP 20371350
MIRT067975 hsa-miR-30a-5p PAR-CLIP 20371350
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
RB1 Repression 8223441
RBL1 Repression 8223441
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
45
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 7739537
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
189902 11749 ENSG00000198176
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14186
Protein name Transcription factor Dp-1 (DRTF1-polypeptide 1) (DRTF1) (E2F dimerization partner 1)
Protein function Can stimulate E2F-dependent transcription. Binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation
PDB 2AZE , 5GOW , 5TUU , 5TUV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02319 E2F_TDP 112 193 E2F/DP family winged-helix DNA-binding domain Domain
PF08781 DP 200 338 Transcription factor DP Domain
Tissue specificity TISSUE SPECIFICITY: Highest levels in muscle. Also expressed in brain, placenta, liver and kidney. Lower levels in lung and pancreas. Not detected in heart.
Sequence
MAKDAGLIEANGELKVFIDQNLSPGKGVVSLVAVHPSTVNPLGKQLLPKTFGQSNVNIAQ
QVVIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKNGKGLRHFS
MKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMN
IISKEKKEIKWIG
LPTNSAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRN
RHAEQQASRPPPPNSVIHLPFIIVNTSKKTVIDCSISNDKFEYLFNFDNTFEIHDDIEVL
KRMGMACGLESGSCSAEDLKMARSLVPKALEPYVTEMA
QGTVGGVFITTAGSTSNGTRFS
ASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDEDD
Sequence length 410
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Polycomb repressive complex
Cell cycle
TGF-beta signaling pathway
  Activation of NOXA and translocation to mitochondria
Transcription of E2F targets under negative control by DREAM complex
Activation of PUMA and translocation to mitochondria
G0 and Early G1
Pre-NOTCH Transcription and Translation
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
Oxidative Stress Induced Senescence
Oncogene Induced Senescence
TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
Cyclin E associated events during G1/S transition
G1/S-Specific Transcription
Cyclin D associated events in G1
Cyclin A:Cdk2-associated events at S phase entry
Transcriptional Regulation by E2F6
Transcriptional regulation of granulopoiesis