Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7022
Gene name Gene Name - the full gene name approved by the HGNC.
Transcription factor AP-2 gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TFAP2C
Synonyms (NCBI Gene) Gene synonyms aliases
AP2-GAMMA, ERF1, TFAP2G, hAP-2g
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.31
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The encoded protein can act as either a homodimer or heterodimer with other family members and is induced d
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006367 hsa-miR-10b-5p Luciferase reporter assay, Western blot 21471404
MIRT006384 hsa-miR-29c-3p Luciferase reporter assay 21436257
MIRT006367 hsa-miR-10b-5p Luciferase reporter assay, Western blot 21471404
MIRT006384 hsa-miR-29c-3p Luciferase reporter assay 21436257
MIRT006367 hsa-miR-10b-5p Luciferase reporter assay, Western blot 21471404
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 24413532
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601602 11744 ENSG00000087510
Protein
UniProt ID Q92754
Protein name Transcription factor AP-2 gamma (AP2-gamma) (Activating enhancer-binding protein 2 gamma) (Transcription factor ERF-1)
Protein function Sequence-specific DNA-binding transcription factor that interacts with cellular enhancer elements to regulate transcription of selected genes, and which plays a key role in early embryonic development (PubMed:11694877, PubMed:24413532). AP-2 fac
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03299 TF_AP-2 224 419 Transcription factor AP-2 Family
Sequence
MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTGVAEYQPPPYF
PPPYQQLAYSQSADPYSHLGEAYAAAINPLHQPAPTGSQQQAWPGRQSQEGAGLPSHHGR
PAGLLPHLSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNV
DDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEVFCSVPGRLSLLSSTSKY
KVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAAHVT
LLTSLVEGEAVHLARDFAYVCEAEFPSKPVAEYLTRPHLGGRNEMAARKNMLLAAQQLCK
EFTELLSQDRTPHGTSRLAPVLETNIQNCLSHFSLITHGFGSQAICAAVSALQNYIKEA
L
IVIDKSYMNPGDQSPADSNKTLEKMEKHRK
Sequence length 450
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    SUMOylation of transcription factors
Negative regulation of activity of TFAP2 (AP-2) family transcription factors
TFAP2 (AP-2) family regulates transcription of other transcription factors
Activation of the TFAP2 (AP-2) family of transcription factors
TFAP2 (AP-2) family regulates transcription of growth factors and their receptors
TFAP2 (AP-2) family regulates transcription of cell cycle factors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Microcephaly microcephaly N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 30670912
Alzheimer Disease Associate 37549144
Breast Neoplasms Associate 10497269, 11278455, 12733991, 12833450, 15467710, 18825690, 19129556, 19458056, 19798054, 19906305, 20629094, 21572391, 22371483, 22964634, 23334330
View all (11 more)
Breast Neoplasms Inhibit 16867219
Breast Neoplasms Stimulate 19671168
Carcinogenesis Associate 19671168, 20629094, 22371483, 31296259, 35563688
Carcinoma Adenoid Cystic Stimulate 12368205
Carcinoma Intraductal Noninfiltrating Associate 15467710
Carcinoma Non Small Cell Lung Associate 31296259
Diffuse Intrinsic Pontine Glioma Associate 30124166