Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7015
Gene name Gene Name - the full gene name approved by the HGNC.
Telomerase reverse transcriptase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TERT
Synonyms (NCBI Gene) Gene synonyms aliases
CMM9, DKCA2, DKCB4, EST2, PFBMFT1, TCS1, TP2, TRT, hEST2, hTRT
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p15.33
Summary Summary of gene provided in NCBI Entrez Gene.
Telomerase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The enzyme consists of a protein component with reverse transcriptase activity, encoded by this gene, and an RNA component which serves as
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs34094720 G>A,T Pathogenic, benign-likely-benign, likely-benign Non coding transcript variant, coding sequence variant, missense variant
rs34528119 G>A,T Conflicting-interpretations-of-pathogenicity, uncertain-significance, benign, likely-benign Intron variant, coding sequence variant, synonymous variant, missense variant
rs35719940 C>T Likely-benign, risk-factor, benign, conflicting-interpretations-of-pathogenicity Non coding transcript variant, coding sequence variant, missense variant
rs111576740 T>C,G Pathogenic Splice acceptor variant
rs121918661 C>T Likely-benign, pathogenic, uncertain-significance, likely-pathogenic Missense variant, coding sequence variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003991 hsa-miR-138-5p qRT-PCR, Luciferase reporter assay, Western blot 18201269
MIRT003991 hsa-miR-138-5p qRT-PCR, Luciferase reporter assay, Western blot 18201269
MIRT003991 hsa-miR-138-5p Luciferase reporter assay 18201269
MIRT006931 hsa-miR-498 Luciferase reporter assay 23055531
MIRT016371 hsa-miR-193b-3p Microarray 20304954
Transcription factors
Transcription factor Regulation Reference
BMI1 Repression 19903340
CTCF Repression 16326864;19914212
DNMT1 Activation 19914212
E2F1 Activation 21411498;22207128
E2F1 Repression 21411498;22207128
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000049 Function TRNA binding IDA 21937513
GO:0000333 Component Telomerase catalytic core complex IBA
GO:0000333 Component Telomerase catalytic core complex IDA 9398860, 9443919, 16507993, 17940095, 18082603
GO:0000333 Component Telomerase catalytic core complex IEA
GO:0000333 Component Telomerase catalytic core complex IMP 11313459
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
187270 11730 ENSG00000164362
Protein
UniProt ID O14746
Protein name Telomerase reverse transcriptase (EC 2.7.7.49) (HEST2) (Telomerase catalytic subunit) (Telomerase-associated protein 2) (TP2)
Protein function Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. Catalytic component of the teleromer
PDB 2BCK , 4B18 , 4MNQ , 5MEN , 5MEO , 5MEP , 5MEQ , 5MER , 5UGW , 7BG9 , 7QXA , 7QXB , 7QXS , 7TRD , 7TRE , 7TRF , 7V99
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12009 Telomerase_RBD 460 592 Telomerase ribonucleoprotein complex - RNA binding domain Domain
PF00078 RVT_1 802 915 Reverse transcriptase (RNA-dependent DNA polymerase) Family
Tissue specificity TISSUE SPECIFICITY: Expressed at a high level in thymocyte subpopulations, at an intermediate level in tonsil T-lymphocytes, and at a low to undetectable level in peripheral blood T-lymphocytes. {ECO:0000269|PubMed:8676067, ECO:0000269|PubMed:9389643}.
Sequence
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW
DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR
SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA
ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR
GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG
RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL
VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS
RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI
LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQH
LKRVQLRE
LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA
LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI
PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL
QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL
LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL
RKTVVNFPVEDEALG
GTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTF
NRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP
FHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL
KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
Sequence length 1132
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Pathways in cancer
Hepatocellular carcinoma
Gastric cancer
  Telomere Extension By Telomerase
Formation of the beta-catenin:TCF transactivating complex
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
acute myeloid leukemia Acute myeloid leukemia rs797046041 N/A
Aplastic anemia aplastic anemia rs199422298, rs199422305 N/A
Dyskeratosis Congenita dyskeratosis congenita, autosomal dominant 1, dyskeratosis congenita, autosomal dominant 2, dyskeratosis congenita rs1554041299, rs199422297, rs121918666, rs915854031, rs886039438, rs938938578, rs199422298, rs745590324, rs121918665, rs199422305, rs199422294, rs387907249, rs770066110 N/A
hepatocellular carcinoma Hepatocellular carcinoma rs1554040964, rs1554043088 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Anxiety Disorder Anxiety N/A N/A GWAS
Breast Cancer Breast cancer (estrogen-receptor negative, progesterone-receptor negative, and human epidermal growth factor-receptor negative), Breast Cancer in BRCA1 mutation carriers, Malignant tumor of breast N/A N/A GWAS, ClinVar
Breast cancer Breast cancer (estrogen-receptor negative), Breast cancer N/A N/A GWAS
Breast Carcinoma breast carcinoma N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 19836008, 20700438, 23221128, 23738012, 24390616, 24420154, 26149460, 26425038, 26590902, 26980028, 27393504, 29924316, 31630874, 32257438, 33393640
View all (3 more)
Adenocarcinoma Follicular Associate 31077238, 31669704, 33197629, 34497362, 35864728, 36637642, 37486076, 38184773
Adenocarcinoma of Lung Associate 20700438, 22370939, 23555636, 24390616, 24420154, 24761905, 25233467, 26497366, 26590902, 27191258, 27501781, 29859855, 32257438, 33879171
Adenoma Associate 10429648, 24472434, 24898513, 28272680, 32932803, 37598154
Adenoma Liver Cell Associate 37169258
Adenoma Pleomorphic Associate 29946183, 34128136
Adenomatous Polyposis Coli Associate 24472434, 37150235
Adenosarcoma Associate 28267263
Adenosarcoma of the uterus Associate 26592504
Adrenal Gland Neoplasms Associate 24803525