Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7008
Gene name Gene Name - the full gene name approved by the HGNC.
TEF transcription factor, PAR bZIP family member
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TEF
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the PAR (proline and acidic amino acid-rich) subfamily of basic region/leucine zipper (bZIP) transcription factors. It is expressed in a broad range of cells and tissues in adult animals, however, during embryonic development
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021130 hsa-miR-186-5p Sequencing 20371350
MIRT046057 hsa-miR-125b-5p CLASH 23622248
MIRT053156 hsa-miR-125a-5p qRT-PCR 24675842
MIRT698678 hsa-miR-499a-3p HITS-CLIP 23313552
MIRT698677 hsa-miR-499b-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0005515 Function Protein binding IPI 25416956, 32814053, 32911434
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
188595 11722 ENSG00000167074
Protein
UniProt ID Q10587
Protein name Thyrotroph embryonic factor
Protein function Transcription factor that binds to and transactivates the TSHB promoter. Binds to a minimal DNA-binding sequence 5'-[TC][AG][AG]TTA[TC][AG]-3'.
PDB 4U5T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07716 bZIP_2 232 285 Basic region leucine zipper Coiled-coil
Sequence
MSDAGGGKKPPVDPQAGPGPGPGRAAGERGLSGSFPLVLKKLMENPPREARLDKEKGKEK
LEEDEAAAASTMAVSASLMPPIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAHN
LLLPVAELEGKESASSSTASPPSSSTAIFQPSETVSSTESSLEKERETPSPIDPNCVEVD
VNFNPDPADLVLSSVPGGELFNPRKHKFAEEDLKPQPMIKKAKKVFVPDEQKDEKYWTRR
KKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRTEVAELRKE
VGKCKTIVSKYETKY
GPL
Sequence length 303
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Multiple sclerosis Multiple Sclerosis rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039
View all (4 more)
24076602
Unknown
Disease term Disease name Evidence References Source
Mental depression Unipolar Depression, Major Depressive Disorder 24581835 ClinVar
Vitiligo Vitiligo GWAS
Eczema Eczema GWAS
Hypothyroidism Hypothyroidism GWAS
Associations from Text Mining
Disease Name Relationship Type References
Anxiety Associate 33834695
Breast Neoplasms Associate 39201344
Choriocarcinoma Associate 11313339
Depressive Disorder Associate 23138696, 24581835, 33834695
Depressive Disorder Major Associate 24581835
Neoplasms Associate 17057225, 36497182
Parkinson Disease Associate 23138696, 24581835, 33834695
Precursor B Cell Lymphoblastic Leukemia Lymphoma Associate 31575852
Prostatic Neoplasms Associate 28380430
Sleep Wake Disorders Associate 24581835, 33834695