Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7006
Gene name Gene Name - the full gene name approved by the HGNC.	Tec protein tyrosine kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TEC
Synonyms (NCBI Gene) Gene synonyms aliases	PSCTK4
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4p12-p11
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. Tec family kinases are involved in the intracellular signaling mechanisms of cytokine receptors, lymphocyte surfac

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	IBA	21873635
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA	21873635
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	10518561
GO:0005515	Function	Protein binding	IPI	8892607, 10518561, 24728074, 25825872
GO:0005524	Function	ATP binding	IEA
GO:0005543	Function	Phospholipid binding	NAS	10518561
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IDA	9299487, 9652744
GO:0005886	Component	Plasma membrane	IDA
GO:0006468	Process	Protein phosphorylation	TAS	7934162
GO:0007229	Process	Integrin-mediated signaling pathway	IBA	21873635
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	9652744
GO:0010543	Process	Regulation of platelet activation	IBA	21873635
GO:0010543	Process	Regulation of platelet activation	IDA	9299487, 9652744
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	10518561
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	IBA	21873635
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	IMP	10518561
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042246	Process	Tissue regeneration	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	10518561
GO:0050852	Process	T cell receptor signaling pathway	IBA	21873635
GO:0050853	Process	B cell receptor signaling pathway	IBA	21873635
GO:0050853	Process	B cell receptor signaling pathway	IDA	10518561

MIM	HGNC	e!Ensembl
600583	11719	ENSG00000135605

Protein

UniProt ID

P42680

Protein name

Tyrosine-protein kinase Tec (EC 2.7.10.2)

Protein function

Non-receptor tyrosine kinase that contributes to signaling from many receptors and participates as a signal transducer in multiple downstream pathways, including regulation of the actin cytoskeleton. Plays a redundant role to ITK in regulation o

PDB

2LUL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	5 → 111	PH domain	Domain
PF00779	BTK	119 → 148	BTK motif	Motif
PF00018	SH3_1	185 → 231	SH3 domain	Domain
PF00017	SH2	247 → 330	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	370 → 619	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a wide range of cells, including hematopoietic cell lines like myeloid, B-, and T-cell lineages.

Sequence

MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIK
CVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKY
HPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNS
EEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSN
NLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHY
HIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSY
EKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKL
THPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYL
ERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYS
RFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLR
CWQEKPEGRPSFEDLLRTIDELVECEETFGR

Sequence length

631

Interactions

View interactions

	KEGG		Reactome
	Osteoclast differentiation T cell receptor signaling pathway		Signaling by SCF-KIT FCERI mediated Ca+2 mobilization Interleukin-3, Interleukin-5 and GM-CSF signaling

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	24390342

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Psoriasis	Psoriasis			GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Arthritis Gouty	Associate	18512796
Bruton type agammaglobulinemia	Associate	10688822, 9280283, 9446655
Chondrosarcoma Extraskeletal Myxoid	Associate	12598313, 17302560
COVID 19	Associate	36736734
Crohn Disease	Associate	21437271
Diabetes Mellitus	Associate	36736734
Diabetes Mellitus Type 2	Associate	36736734
Gout	Associate	18512796
Leukemia Lymphocytic Chronic B Cell	Associate	34912339
Neoplasms	Associate	12598313, 17302560
Pancreatic Neoplasms	Associate	33213062

TEC (tec protein tyrosine kinase)