TEC (tec protein tyrosine kinase)

Gene

• Entrez ID: 7006
• Gene name: Tec protein tyrosine kinase
• Gene symbol: TEC
• Synonyms (NCBI Gene): PSCTK4
• Chromosome: 4
• Chromosome location: 4p12-p11
• Summary: The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. Tec family kinases are involved in the intracellular signaling mechanisms of cytokine receptors, lymphocyte surfac

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002250	Process	Adaptive immune response	IBA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	10518561
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS	7934162
GO:0005515	Function	Protein binding	IPI	8892607, 10518561, 24728074, 25825872
GO:0005524	Function	ATP binding	IEA
GO:0005543	Function	Phospholipid binding	NAS	10518561
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IDA	9299487, 9652744
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	TAS	7934162
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	9652744
GO:0008270	Function	Zinc ion binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0010543	Process	Regulation of platelet activation	IDA	9299487, 9652744
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	TAS	7934162
GO:0042246	Process	Tissue regeneration	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050852	Process	T cell receptor signaling pathway	IBA
GO:0050853	Process	B cell receptor signaling pathway	IBA
GO:0050853	Process	B cell receptor signaling pathway	IDA	10518561

Other IDs

• MIM: 600583
• HGNC: 11719
• e!Ensembl: ENSG00000135605

Protein

• UniProt ID: P42680
• Protein name: Tyrosine-protein kinase Tec (EC 2.7.10.2)
• Protein function: Non-receptor tyrosine kinase that contributes to signaling from many receptors and participates as a signal transducer in multiple downstream pathways, including regulation of the actin cytoskeleton. Plays a redundant role to ITK in regulation o
• PDB: 2LUL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	5 → 111	PH domain	Domain
  PF00779	BTK	119 → 148	BTK motif	Motif
  PF00018	SH3_1	185 → 231	SH3 domain	Domain
  PF00017	SH2	247 → 330	SH2 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	370 → 619	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in a wide range of cells, including hematopoietic cell lines like myeloid, B-, and T-cell lineages.
• Sequence:

  MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIK
  CVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKY
  HPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNS
  EEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSN
  NLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHY
  HIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSY
  EKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKL
  THPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYL
  ERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYS
  RFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLR
  CWQEKPEGRPSFEDLLRTIDELVECEETFGR

• Sequence length: 631

Pathways

KEGG:

Osteoclast differentiation
T cell receptor signaling pathway

Reactome:

Signaling by SCF-KIT
FCERI mediated Ca+2 mobilization
Interleukin-3, Interleukin-5 and GM-CSF signaling

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Clear cell carcinoma of kidney	Uncertain significance	rs140868704	RCV005930691
Colon adenocarcinoma	Uncertain significance	rs763650133	RCV005932162
Thyroid cancer, nonmedullary, 1	Uncertain significance	rs140868704	RCV005930692

Associations from Text Mining
Disease Name	Relationship Type	References
Arthritis Gouty	Associate	18512796
Bruton type agammaglobulinemia	Associate	10688822, 9280283, 9446655
Chondrosarcoma Extraskeletal Myxoid	Associate	12598313, 17302560
COVID 19	Associate	36736734
Crohn Disease	Associate	21437271
Diabetes Mellitus	Associate	36736734
Diabetes Mellitus Type 2	Associate	36736734
Gout	Associate	18512796
Leukemia Lymphocytic Chronic B Cell	Associate	34912339
Neoplasms	Associate	12598313, 17302560
Pancreatic Neoplasms	Associate	33213062