Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6997
Gene name	Cripto, EGF-CFC family member
Gene symbol	CRIPTO
Synonyms (NCBI Gene)	CRCR-1CRGFTDGF1
Chromosome	3
Chromosome location	3p21.31

Show/Hide all (77)

miRTarBase ID	miRNA	Experiments
MIRT1416955	hsa-miR-3122	CLIP-seq
MIRT1416956	hsa-miR-3148	CLIP-seq
MIRT1416957	hsa-miR-3153	CLIP-seq
MIRT1416958	hsa-miR-365	CLIP-seq
MIRT1416959	hsa-miR-374a	CLIP-seq
MIRT1416960	hsa-miR-374b	CLIP-seq
MIRT1416961	hsa-miR-3913-5p	CLIP-seq
MIRT1416962	hsa-miR-4668-5p	CLIP-seq
MIRT1416963	hsa-miR-532-5p	CLIP-seq
MIRT1416964	hsa-miR-1262	CLIP-seq
MIRT1416965	hsa-miR-1303	CLIP-seq
MIRT1416966	hsa-miR-3672	CLIP-seq
MIRT1416967	hsa-miR-3675-3p	CLIP-seq
MIRT1416968	hsa-miR-3978	CLIP-seq
MIRT1416969	hsa-miR-455-3p	CLIP-seq
MIRT1416970	hsa-miR-4684-5p	CLIP-seq
MIRT1416971	hsa-miR-4701-3p	CLIP-seq
MIRT1416972	hsa-miR-4786-5p	CLIP-seq
MIRT1416973	hsa-miR-4797-5p	CLIP-seq
MIRT1416974	hsa-miR-542-3p	CLIP-seq
MIRT1416975	hsa-miR-548c-3p	CLIP-seq
MIRT1416976	hsa-miR-630	CLIP-seq
MIRT1416977	hsa-miR-661	CLIP-seq
MIRT1416978	hsa-miR-759	CLIP-seq
MIRT2125058	hsa-miR-1827	CLIP-seq
MIRT2125059	hsa-miR-3689a-3p	CLIP-seq
MIRT2125060	hsa-miR-3689c	CLIP-seq
MIRT2125061	hsa-miR-3929	CLIP-seq
MIRT2125062	hsa-miR-4419b	CLIP-seq
MIRT2125063	hsa-miR-4478	CLIP-seq
MIRT2125064	hsa-miR-4643	CLIP-seq
MIRT2125065	hsa-miR-4649-3p	CLIP-seq
MIRT2125066	hsa-miR-4722-5p	CLIP-seq
MIRT2125067	hsa-miR-4728-5p	CLIP-seq
MIRT2125068	hsa-miR-4768-3p	CLIP-seq
MIRT2125069	hsa-miR-485-5p	CLIP-seq
MIRT2125070	hsa-miR-642b	CLIP-seq
MIRT2125071	hsa-miR-890	CLIP-seq
MIRT2125072	hsa-miR-935	CLIP-seq
MIRT2125073	hsa-miR-940	CLIP-seq
MIRT2347484	hsa-miR-193a-3p	CLIP-seq
MIRT2347485	hsa-miR-193b	CLIP-seq
MIRT2347486	hsa-miR-299-5p	CLIP-seq
MIRT2347487	hsa-miR-3614-5p	CLIP-seq
MIRT2347488	hsa-miR-3926	CLIP-seq
MIRT2347489	hsa-miR-4463	CLIP-seq
MIRT2347490	hsa-miR-4494	CLIP-seq
MIRT2125064	hsa-miR-4643	CLIP-seq
MIRT1416972	hsa-miR-4786-5p	CLIP-seq
MIRT2347491	hsa-miR-548s	CLIP-seq
MIRT2125070	hsa-miR-642b	CLIP-seq
MIRT2125071	hsa-miR-890	CLIP-seq
MIRT2125072	hsa-miR-935	CLIP-seq
MIRT2640423	hsa-miR-1285	CLIP-seq
MIRT2640424	hsa-miR-3187-5p	CLIP-seq
MIRT2640425	hsa-miR-3613-3p	CLIP-seq
MIRT2640426	hsa-miR-3622b-5p	CLIP-seq
MIRT1416967	hsa-miR-3675-3p	CLIP-seq
MIRT2125059	hsa-miR-3689a-3p	CLIP-seq
MIRT2125060	hsa-miR-3689c	CLIP-seq
MIRT2640427	hsa-miR-3945	CLIP-seq
MIRT2640428	hsa-miR-4253	CLIP-seq
MIRT1416970	hsa-miR-4684-5p	CLIP-seq
MIRT2125067	hsa-miR-4728-5p	CLIP-seq
MIRT1416975	hsa-miR-548c-3p	CLIP-seq
MIRT2640429	hsa-miR-612	CLIP-seq
MIRT2125071	hsa-miR-890	CLIP-seq
MIRT2125072	hsa-miR-935	CLIP-seq
MIRT2640423	hsa-miR-1285	CLIP-seq
MIRT2640424	hsa-miR-3187-5p	CLIP-seq
MIRT2640425	hsa-miR-3613-3p	CLIP-seq
MIRT1416967	hsa-miR-3675-3p	CLIP-seq
MIRT2640427	hsa-miR-3945	CLIP-seq
MIRT2640428	hsa-miR-4253	CLIP-seq
MIRT1416970	hsa-miR-4684-5p	CLIP-seq
MIRT1416975	hsa-miR-548c-3p	CLIP-seq
MIRT2640429	hsa-miR-612	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
POU5F1	Activation	17068183

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001568	Process	Blood vessel development	IBA
GO:0001763	Process	Morphogenesis of a branching structure	TAS	10070255
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IMP	17720976
GO:0005102	Function	Signaling receptor binding	IDA	11909953
GO:0005515	Function	Protein binding	IPI	12919325
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	17720976
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	8006041
GO:0007368	Process	Determination of left/right symmetry	IBA
GO:0007507	Process	Heart development	IBA
GO:0007507	Process	Heart development	IDA	9576836
GO:0008083	Function	Growth factor activity	IDA	8006041, 12925698
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	8006041
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	11857442
GO:0008595	Process	Anterior/posterior axis specification, embryo	ISS
GO:0009792	Process	Embryo development ending in birth or egg hatching	TAS	11857442
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0009966	Process	Regulation of signal transduction	IDA	12649175
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	12925698
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	17720976
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	17720976
GO:0030154	Process	Cell differentiation	TAS	11857442
GO:0030335	Process	Positive regulation of cell migration	IDA	12649175
GO:0030879	Process	Mammary gland development	TAS	11857442
GO:0035729	Process	Cellular response to hepatocyte growth factor stimulus	IDA	17720976
GO:0038092	Process	Nodal signaling pathway	IBA
GO:0038100	Function	Nodal binding	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	10493495
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	9013573
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	9013573
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IDA	17720976
GO:0045121	Component	Membrane raft	IDA	17720976
GO:0070697	Function	Activin receptor binding	IBA
GO:0071346	Process	Cellular response to type II interferon	IDA	17720976
GO:0071354	Process	Cellular response to interleukin-6	IDA	17720976
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	17720976
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IDA	17720976
GO:0098552	Component	Side of membrane	IEA

MIM	HGNC	e!Ensembl
187395	11701	ENSG00000241186

P13385

Protein name

Protein Cripto (Cripto, EGF-CFC family member) (Cripto-1 growth factor) (CRGF) (Epidermal growth factor-like cripto protein CR1) (Teratocarcinoma-derived growth factor 1)

Protein function

GPI-anchored cell membrane protein involved in Nodal signaling. Cell-associated CRIPTO acts as a Nodal coreceptor in cis. Shedding of CRIPTO by TMEM8A modulates Nodal signaling by allowing soluble CRIPTO to act as a Nodal coreceptor on other cel

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09443	CFC	115 → 149	Cripto_Frl-1_Cryptic (CFC)	Domain

Tissue specificity

TISSUE SPECIFICITY: Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. Expressed in breast and lung. {ECO:0000269|PubMed:18835250}.

Sequence

MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIR
PRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPH
DTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGI
CLSIQSYY

Sequence length

188

Interactions

View interactions

	Reactome
			POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
CRIPTO-related disorder	Uncertain significance; Benign	rs1215656011, rs150809256	RCV003391656 RCV003915980
Forebrain defects	Uncertain significance	rs121909501	RCV000013565

CRIPTO (cripto, EGF-CFC family member)