TRA (T cell receptor alpha locus)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6955
Gene name Gene Name - the full gene name approved by the HGNC.
T cell receptor alpha locus
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRA
Synonyms (NCBI Gene) Gene synonyms aliases
IMD7, TCRA, TRA@
Disease Acronyms (UniProt) Disease acronyms from UniProt database
IMD7
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q11.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT737032 hsa-miR-193a-3p Luciferase reporter assay, Western blotting, Flow cytometry 34288281
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
Transcription factor Regulation Reference
ETS1 Activation 1535773
ETS1 Unknown 2237431
GATA3 Unknown 11385613
POU2F1 Unknown 11385613
POU2F2 Unknown 11385613
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(5)
GO ID Ontology Definition Evidence Reference
GO:0002355 Process Detection of tumor cell IDA 31959982
GO:0002419 Process T cell mediated cytotoxicity directed against tumor cell target IDA 31959982
GO:0016021 Component Integral component of membrane IEA
GO:0038023 Function Signaling receptor activity IDA 31959982
GO:0042105 Component Alpha-beta T cell receptor complex IDA 31959982
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC 12027 N/A
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID P0DSE1
Protein name M1-specific T cell receptor alpha chain (TR alpha chain TRAV27*01J42*01C*01)
Protein function The alpha chain of TRAV27*01J42*01C*01/TRBV19*01J2S7*01C*02 alpha-beta T cell receptor (TR) clonotype that is specific for HLA-A*02:01-restricted M/matrix protein 1 immunodominant epitope GILGFVFTL of influenza A virus (IAV). Classified as a pub
PDB 1OGA , 2VLJ , 2VLK , 2VLR , 5HHM , 5HHO
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in M/matrix protein 1-specific effector and memory CD8-positive T cells readily detectable in the peripheral blood, secondary lymphoid organs and lung (primary site of infection) of IAV infected individuals. {ECO:0000269|PubM
Sequence 
MVLKFSVSILWIQLAWVSTQLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEG
PVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGGGSQGNLIFGK
GTKLSVKPIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMR
SMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQ
NLSVIGFRILLLKVAGFNLLMTLRLWSS
Sequence length 268
UniProt ID P0DTU3
Protein name T cell receptor alpha chain MC.7.G5 (MC.7.G5 TRA) (TR alpha chain TRAV38-2DV8*01J31*01C*01)
Protein function The alpha chain of TRAV38-2DV8*01J31*01C*01/TRBV25-1*01J2S3*01C2*01 alpha-beta T cell receptor (TR) clonotype that displays pan-cancer cell recognition via the invariant MR1 molecule. On CD8-positive T cell clone MC.7.G5, likely recognizes tumor
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in MR1-restricted CD8-positive T cells. {ECO:0000269|PubMed:31959982}.
Sequence 
MACPGFLWALVISTCLEFSMAQTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQP
PSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRSAVNA
RLMFGDGTQLVVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITD
KTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFET
DTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS
Sequence length 275
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Lymphoblastic leukemia Precursor T-Cell Lymphoblastic Leukemia-Lymphoma, Precursor T-cell acute lymphoblastic leukemia rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699
View all (13 more)		 29279377
Narcolepsy Narcolepsy rs104894574, rs387906655 19412176
Show/Hide Text Mining Associations (27)
Associations from Text Mining
Disease Name Relationship Type References
Anemia Associate 28911146
Attention Deficit Disorder with Hyperactivity Associate 32217468
Breast Neoplasms Associate 16282247
Carcinoma Basal Cell Associate 33509032
Carcinoma Ductal Breast Associate 16282247
Carcinoma Hepatocellular Associate 16434963
Carcinoma Hepatocellular Stimulate 27174710
Constipation Associate 33509032
Hallucinations Associate 31343434
HEM dysplasia Associate 33509032