TRA (T cell receptor alpha locus)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein
Entrez ID 6955
Gene name T cell receptor alpha locus
Gene symbol TRA
Synonyms (NCBI Gene)
IMD7TCRATRA@
Chromosome 14
Chromosome location 14q11.2
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT737032 hsa-miR-193a-3p Luciferase reporter assayWestern blottingFlow cytometry 34288281
Transcription factors Transcription factors information provided by TRRUST V2 database.
7
Gene miRNA Transcription factors Gene ontology Other IDs Protein
Show/Hide all (7)
Transcription factor Regulation Reference
ETS1 Activation 1535773
ETS1 Unknown 2237431
GATA3 Unknown 11385613
POU2F1 Unknown 11385613
POU2F2 Unknown 11385613
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Transcription factors Gene ontology Other IDs Protein
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002355 Process Detection of tumor cell IDA 31959982
GO:0002376 Process Immune system process IEA
GO:0002419 Process T cell mediated cytotoxicity directed against tumor cell target IDA 31959982
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
HGNC 12027 N/A
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DSE1
Protein name M1-specific T cell receptor alpha chain (TR alpha chain TRAV27*01J42*01C*01)
Protein function The alpha chain of TRAV27*01J42*01C*01/TRBV19*01J2S7*01C*02 alpha-beta T cell receptor (TR) clonotype that is specific for HLA-A*02:01-restricted M/matrix protein 1 immunodominant epitope GILGFVFTL of influenza A virus (IAV). Classified as a pub
PDB 1OGA , 2VLJ , 2VLK , 2VLR , 5HHM , 5HHO
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in M/matrix protein 1-specific effector and memory CD8-positive T cells readily detectable in the peripheral blood, secondary lymphoid organs and lung (primary site of infection) of IAV infected individuals. {ECO:0000269|PubM
Sequence 
MVLKFSVSILWIQLAWVSTQLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEG
PVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGGGSQGNLIFGK
GTKLSVKPIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMR
SMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQ
NLSVIGFRILLLKVAGFNLLMTLRLWSS
Sequence length 268
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DTU3
Protein name T cell receptor alpha chain MC.7.G5 (MC.7.G5 TRA) (TR alpha chain TRAV38-2DV8*01J31*01C*01)
Protein function The alpha chain of TRAV38-2DV8*01J31*01C*01/TRBV25-1*01J2S3*01C2*01 alpha-beta T cell receptor (TR) clonotype that displays pan-cancer cell recognition via the invariant MR1 molecule. On CD8-positive T cell clone MC.7.G5, likely recognizes tumor
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in MR1-restricted CD8-positive T cells. {ECO:0000269|PubMed:31959982}.
Sequence 
MACPGFLWALVISTCLEFSMAQTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQP
PSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRSAVNA
RLMFGDGTQLVVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITD
KTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFET
DTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS
Sequence length 275
Interactions View interactions