Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6954
Gene name Gene Name - the full gene name approved by the HGNC.	T-complex 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TCP11
Synonyms (NCBI Gene) Gene synonyms aliases	D6S230E, FPPR
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.31

Show/Hide all(7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023346	hsa-miR-122-5p	Microarray	17612493
MIRT1416684	hsa-miR-3921	CLIP-seq
MIRT1416685	hsa-miR-4303	CLIP-seq
MIRT1416686	hsa-miR-4537	CLIP-seq
MIRT1416687	hsa-miR-4653-5p	CLIP-seq
MIRT1416688	hsa-miR-4685-5p	CLIP-seq
MIRT1416689	hsa-miR-760	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IBA
GO:0001669	Component	Acrosomal vesicle	IDA	21597245
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001669	Component	Acrosomal vesicle	ISS
GO:0005515	Function	Protein binding	IPI	21597245, 32296183
GO:0005929	Component	Cilium	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007281	Process	Germ cell development	IEP	1893875
GO:0007283	Process	Spermatogenesis	IEA
GO:0010737	Process	Protein kinase A signaling	IBA
GO:0010737	Process	Protein kinase A signaling	ISS
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0036126	Component	Sperm flagellum	IBA
GO:0036126	Component	Sperm flagellum	IDA	21597245
GO:0036126	Component	Sperm flagellum	ISS
GO:0042995	Component	Cell projection	IEA
GO:0097225	Component	Sperm midpiece	ISS
GO:1902490	Process	Regulation of sperm capacitation	IBA
GO:1902490	Process	Regulation of sperm capacitation	ISS

MIM	HGNC	e!Ensembl
186982	11658	ENSG00000124678

Protein

UniProt ID

Q8WWU5

Protein name

T-complex protein 11 homolog

Protein function

Plays a role in the process of sperm capacitation and acrosome reactions. Probable receptor for the putative fertilization-promoting peptide (FPP) at the sperm membrane that may modulate the activity of the adenylyl cyclase cAMP pathway. {ECO:00

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05794	Tcp11	58 → 487	T-complex protein 11	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform 2 and isoform 3 are expressed in sperm. Isoform 1 is not detected in sperm (at protein level) (PubMed:21597245). Testis-specific (PubMed:11756566). Isoform 1, isoform 2 and isoform 3 are expressed in sperm (PubMed:21597245). {E

Sequence

MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPFLSVTGLTETVNEVSKLSN
KIGMNCDYYMEEKVLPPSSLEGKVKETVHNAFWDHLKEQLSATPPDFSCALELLKEIKEI
LLSLLLPRQNRLRIEIEEALDMDLLKQEAEHGALKVLYLSKYVLNMMALLCAPVRDEAVQ
KLENITDPVWLLRGIFQVLGRMKMDMVNYTIQSLQPHLQEHSIQYERAKFQELLNKQPSL
LNHTTKWLTQAAGDLTMSPPTCPDTSDSSSVAGPSPNEAANNPEPLSPTMVLCQGFLNLL
LWDLENEEFPETLLMDRTRLQELKSQLHQLTVMASVLLVASSFSGSVLFGSPQFVDKLKR
ITKSLLEDFHSRPEEAILTVSEQVSQEIHQSLKNMGLVALSSDNTASLMGQLQNIAKKEN
CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNLTHHNQQVFGP
YYTEILKTLISPAQALETKVESV

Sequence length

503

Interactions

View interactions

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Age of onset of childhood onset asthma, Age of onset of adult onset asthma, Asthma, Asthma (childhood onset)	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Sinusitis	Chronic sinusitis	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Sarcoma	Associate	28088687
Uterine Cervical Neoplasms	Associate	37697257

TCP11 (t-complex 11)