Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6945
Gene name Gene Name - the full gene name approved by the HGNC.
MAX dimerization protein MLX
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MLX
Synonyms (NCBI Gene) Gene synonyms aliases
MAD7, MXD7, TCFL4, TF4, bHLHd13
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene prod
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT028193 hsa-miR-33a-5p Sequencing 20371350
MIRT049076 hsa-miR-92a-3p CLASH 23622248
MIRT046985 hsa-miR-218-5p CLASH 23622248
MIRT045597 hsa-miR-149-5p CLASH 23622248
MIRT044847 hsa-miR-320a CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 10918583
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 10918583
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602976 11645 ENSG00000108788
Protein
UniProt ID Q9UH92
Protein name Max-like protein X (Class D basic helix-loop-helix protein 13) (bHLHd13) (Max-like bHLHZip protein) (Protein BigMax) (Transcription factor-like protein 4)
Protein function Transcription regulator. Forms a sequence-specific DNA-binding protein complex with MAD1, MAD4, MNT, WBSCR14 and MLXIP which recognizes the core sequence 5'-CACGTG-3'. The TCFL4-MAD1, TCFL4-MAD4, TCFL4-WBSCR14 complexes are transcriptional repre
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 130 188 Helix-loop-helix DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues tested, including spleen, thymus, prostate, ovary, intestine, colon, peripheral blood leukocyte, heart, liver, skeletal muscle and kidney. Lower levels of expression in testis, brain, placenta and lung. {ECO:00
Sequence
MTEPGASPEDPWVKASPVGAHAGEGRAGRARARRGAGRRGASLLSPKSPTLSVPRGCRED
SSHPACAKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQE
AYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKT
IDYIQFLH
KEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFN
VFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
Sequence length 298
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Insulin resistance
Non-alcoholic fatty liver disease
  ChREBP activates metabolic gene expression
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes mellitus or coronary artery disease (pleiotropy), Type 2 diabetes (time to event), Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 33083483
Aortic Dissection Associate 33083483
Aortic Valve Insufficiency Associate 30354298
Autoimmune Diseases Associate 23830516
Bone Diseases Metabolic Associate 21092186
Coronary Disease Associate 23840567
Diabetes Mellitus Type 2 Associate 30956117
Hypoxia Inhibit 21192937
Inflammatory Bowel Diseases Associate 23830516
Takayasu Arteritis Associate 23830516, 26996483, 27769046, 30354298