Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	6943
Gene name	Transcription factor 21
Gene symbol	TCF21
Synonyms (NCBI Gene)	POD1bHLHa23
Chromosome	6
Chromosome location	6q23.2
Summary	TCF21 encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells

Show/Hide all (73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006075	hsa-miR-492	MicroarrayqRT-PCR	21319197
MIRT006075	hsa-miR-492	MicroarrayqRT-PCR	21319197
MIRT006075	hsa-miR-492	MicroarrayqRT-PCR	21319197
MIRT007085	hsa-miR-21-5p	Luciferase reporter assay	23206776
MIRT007085	hsa-miR-21-5p	Luciferase reporter assay	23206776
MIRT025053	hsa-miR-181a-5p	Microarray	17612493
MIRT492086	hsa-miR-5088-5p	PAR-CLIP	23592263
MIRT492085	hsa-miR-1234-3p	PAR-CLIP	23592263
MIRT492084	hsa-miR-7107-5p	PAR-CLIP	23592263
MIRT492082	hsa-miR-4721	PAR-CLIP	23592263
MIRT492083	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT492081	hsa-miR-6735-3p	PAR-CLIP	23592263
MIRT492086	hsa-miR-5088-5p	PAR-CLIP	23592263
MIRT492085	hsa-miR-1234-3p	PAR-CLIP	23592263
MIRT492084	hsa-miR-7107-5p	PAR-CLIP	23592263
MIRT492082	hsa-miR-4721	PAR-CLIP	23592263
MIRT492083	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT492081	hsa-miR-6735-3p	PAR-CLIP	23592263
MIRT1416102	hsa-miR-1279	CLIP-seq
MIRT1416103	hsa-miR-142-3p	CLIP-seq
MIRT1416104	hsa-miR-147	CLIP-seq
MIRT1416105	hsa-miR-148a	CLIP-seq
MIRT1416106	hsa-miR-148b	CLIP-seq
MIRT1416107	hsa-miR-152	CLIP-seq
MIRT1416108	hsa-miR-15a	CLIP-seq
MIRT1416109	hsa-miR-15b	CLIP-seq
MIRT1416110	hsa-miR-16	CLIP-seq
MIRT1416111	hsa-miR-195	CLIP-seq
MIRT1416112	hsa-miR-3074-5p	CLIP-seq
MIRT1416113	hsa-miR-3160-5p	CLIP-seq
MIRT1416114	hsa-miR-3170	CLIP-seq
MIRT1416115	hsa-miR-3189-3p	CLIP-seq
MIRT1416116	hsa-miR-342-5p	CLIP-seq
MIRT1416117	hsa-miR-3612	CLIP-seq
MIRT1416118	hsa-miR-3622a-3p	CLIP-seq
MIRT1416119	hsa-miR-3622b-3p	CLIP-seq
MIRT1416120	hsa-miR-3650	CLIP-seq
MIRT1416121	hsa-miR-3908	CLIP-seq
MIRT1416122	hsa-miR-3911	CLIP-seq
MIRT1416123	hsa-miR-3913-3p	CLIP-seq
MIRT1416124	hsa-miR-424	CLIP-seq
MIRT1416125	hsa-miR-4255	CLIP-seq
MIRT1416126	hsa-miR-4259	CLIP-seq
MIRT1416127	hsa-miR-4311	CLIP-seq
MIRT1416128	hsa-miR-4324	CLIP-seq
MIRT1416129	hsa-miR-4326	CLIP-seq
MIRT1416130	hsa-miR-4328	CLIP-seq
MIRT1416131	hsa-miR-4329	CLIP-seq
MIRT1416132	hsa-miR-4530	CLIP-seq
MIRT1416133	hsa-miR-4651	CLIP-seq
MIRT1416134	hsa-miR-4664-5p	CLIP-seq
MIRT1416135	hsa-miR-4697-3p	CLIP-seq
MIRT1416136	hsa-miR-4712-3p	CLIP-seq
MIRT1416137	hsa-miR-4722-3p	CLIP-seq
MIRT1416138	hsa-miR-489	CLIP-seq
MIRT1416139	hsa-miR-497	CLIP-seq
MIRT1416140	hsa-miR-499-3p	CLIP-seq
MIRT1416141	hsa-miR-499a-3p	CLIP-seq
MIRT1416142	hsa-miR-520f	CLIP-seq
MIRT1416143	hsa-miR-541	CLIP-seq
MIRT1416144	hsa-miR-548n	CLIP-seq
MIRT1416145	hsa-miR-548t	CLIP-seq
MIRT1416146	hsa-miR-608	CLIP-seq
MIRT1416147	hsa-miR-634	CLIP-seq
MIRT1416148	hsa-miR-644	CLIP-seq
MIRT1416149	hsa-miR-650	CLIP-seq
MIRT1416150	hsa-miR-654-5p	CLIP-seq
MIRT2347244	hsa-miR-1305	CLIP-seq
MIRT2347245	hsa-miR-4737	CLIP-seq
MIRT1416144	hsa-miR-548n	CLIP-seq
MIRT2347246	hsa-miR-548p	CLIP-seq
MIRT2347247	hsa-miR-562	CLIP-seq
MIRT2347248	hsa-miR-607	CLIP-seq

Show/Hide all (81)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12493738
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	12493738
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001657	Process	Ureteric bud development	IEA
GO:0001657	Process	Ureteric bud development	ISS
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	ISS
GO:0001763	Process	Morphogenesis of a branching structure	IEA
GO:0001763	Process	Morphogenesis of a branching structure	ISS
GO:0001822	Process	Kidney development	IEA
GO:0001822	Process	Kidney development	ISS
GO:0001944	Process	Vasculature development	IEA
GO:0001944	Process	Vasculature development	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005634	Component	Nucleus	IDA	12493738
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007530	Process	Sex determination	IEA
GO:0007530	Process	Sex determination	ISS
GO:0007548	Process	Sex differentiation	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0014707	Process	Branchiomeric skeletal muscle development	IEA
GO:0014707	Process	Branchiomeric skeletal muscle development	ISS
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0030855	Process	Epithelial cell differentiation	ISS
GO:0032502	Process	Developmental process	IBA
GO:0032835	Process	Glomerulus development	IEA
GO:0032835	Process	Glomerulus development	ISS
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043425	Function	BHLH transcription factor binding	IEA
GO:0043425	Function	BHLH transcription factor binding	IPI	12493738
GO:0043425	Function	BHLH transcription factor binding	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048286	Process	Lung alveolus development	IEA
GO:0048286	Process	Lung alveolus development	ISS
GO:0048536	Process	Spleen development	IEA
GO:0048536	Process	Spleen development	ISS
GO:0048557	Process	Embryonic digestive tract morphogenesis	IEA
GO:0048557	Process	Embryonic digestive tract morphogenesis	ISS
GO:0048608	Process	Reproductive structure development	IEA
GO:0048608	Process	Reproductive structure development	ISS
GO:0048732	Process	Gland development	IEA
GO:0048732	Process	Gland development	ISS
GO:0050681	Function	Nuclear androgen receptor binding	IEA
GO:0050681	Function	Nuclear androgen receptor binding	ISS
GO:0060008	Process	Sertoli cell differentiation	IEA
GO:0060008	Process	Sertoli cell differentiation	ISS
GO:0060021	Process	Roof of mouth development	IEA
GO:0060021	Process	Roof of mouth development	ISS
GO:0060425	Process	Lung morphogenesis	IEA
GO:0060425	Process	Lung morphogenesis	ISS
GO:0060426	Process	Lung vasculature development	IEA
GO:0060426	Process	Lung vasculature development	ISS
GO:0060435	Process	Bronchiole development	IEA
GO:0060435	Process	Bronchiole development	ISS
GO:0060539	Process	Diaphragm development	IEA
GO:0060539	Process	Diaphragm development	ISS
GO:0060541	Process	Respiratory system development	IEA
GO:0060541	Process	Respiratory system development	ISS
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IEA
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	ISS
GO:0070888	Function	E-box binding	IEA
GO:0070888	Function	E-box binding	ISS
GO:0072162	Process	Metanephric mesenchymal cell differentiation	IEA
GO:0072162	Process	Metanephric mesenchymal cell differentiation	ISS
GO:0072277	Process	Metanephric glomerular capillary formation	IEA
GO:0072277	Process	Metanephric glomerular capillary formation	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
603306	11632	ENSG00000118526

O43680

Protein name

Transcription factor 21 (TCF-21) (Capsulin) (Class A basic helix-loop-helix protein 23) (bHLHa23) (Epicardin) (Podocyte-expressed 1) (Pod-1)

Protein function

Involved in epithelial-mesenchymal interactions in kidney and lung morphogenesis that include epithelial differentiation and branching morphogenesis. May play a role in the specification or differentiation of one or more subsets of epicardial ce

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	80 → 132	Helix-loop-helix DNA-binding domain	Domain

Sequence

MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRR
KAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDT
LRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS

Sequence length

179

Interactions

View interactions

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Clear cell carcinoma of kidney	Uncertain significance	rs61729591	RCV005888471
Colon adenocarcinoma	Uncertain significance	rs61729591	RCV005888467
Hepatocellular carcinoma	Uncertain significance	rs61729591	RCV005888468
Malignant tumor of esophagus	Uncertain significance	rs61729591	RCV005888469
Nonpapillary renal cell carcinoma	Uncertain significance	rs61729591	RCV005888470
Ovarian serous cystadenocarcinoma	Uncertain significance	rs61729591	RCV005888472
TCF21-related disorder	Likely benign	rs371711846, rs74899812	RCV003913885 RCV003931764

Show/Hide Text Mining Associations (62)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Inhibit	20945327
Adenocarcinoma of Lung	Associate	28515486
Adenomyosis	Stimulate	39326465
Adrenocortical Adenoma	Associate	28658440
Adrenocortical Carcinoma	Associate	28658440
Angina Stable	Associate	38250610
Atherosclerosis	Associate	24676100, 31815603, 37391023
Breast Neoplasms	Inhibit	26044559, 27028856
Breast Neoplasms	Associate	27270650, 32894086
Carcinoma Ductal	Associate	27270650
Carcinoma Hepatocellular	Inhibit	31014118
Carcinoma Hepatocellular	Associate	33985545
Carcinoma Non Small Cell Lung	Associate	20945327, 34050209
Carcinoma Non Small Cell Lung	Stimulate	34050209
Carcinoma Renal Cell	Associate	21847011, 29080283
Carcinoma Squamous Cell	Associate	38084139
Carotid Artery Thrombosis	Associate	35910838
Cholangiocarcinoma	Inhibit	30920845
Colorectal Neoplasms	Associate	38197316
Constriction Pathologic	Associate	35910838
Corneal Endothelial Cell Loss	Associate	31354385
Coronary Artery Disease	Associate	24676100, 26020271, 30146127, 30307970, 31014396, 32513244, 36345357, 37391023, 38250610
Coronary Artery Disease	Inhibit	31815603
Coronary Disease	Associate	23874238, 24676100, 28346832, 31014396, 31815603, 32513244
Diabetes Mellitus Type 2	Associate	37391023, 38250610
Disease	Associate	37391023
Double Outlet Right Ventricle	Associate	28346832
Endometriosis	Associate	31610174, 36650372
Esophageal Neoplasms	Inhibit	29909422
Esophageal Neoplasms	Associate	32487238
Esophageal Squamous Cell Carcinoma	Inhibit	29909422
Fibrosis	Associate	31610174
Friedreich Ataxia	Inhibit	39519164
Glomerulonephritis IGA	Stimulate	38278877
Head and Neck Neoplasms	Associate	18398044, 20945327, 21771727
Heart Diseases	Associate	28346832
Heart Septal Defects Ventricular	Associate	28346832
Hyperlipidemias	Associate	38250610
Hypertension	Associate	38250610
Inflammatory Bowel Diseases	Associate	26020271
Kidney Neoplasms	Associate	29080283
Liver Cirrhosis	Associate	37268177
Lung Neoplasms	Associate	18398044, 19017733, 20945327, 30176158
Lymphatic Metastasis	Inhibit	26044559
Melanoma	Inhibit	21771727, 34424910
N syndrome	Inhibit	29909422
Neoplasm Metastasis	Inhibit	21771727, 29909422
Neoplasm Metastasis	Associate	28663539
Neoplasms	Associate	18616821, 20420713, 20945327, 32434219
Neoplasms	Inhibit	19017733, 21771727, 25087872, 26044559, 26158413, 27270650, 28658440, 28663539, 29080283, 29909422, 30920845, 31014118, 35183243, 35422093, 38197316
Neoplasms Squamous Cell	Associate	18616821
Obesity	Stimulate	26273678
Osteosarcoma	Associate	28663539
Ovarian Diseases	Associate	31610174
Ovarian Neoplasms	Associate	28476165, 32434219, 35183243
Prostatic Neoplasms	Associate	21847011
Renal Insufficiency Chronic	Associate	37391023
Sarcoma Clear Cell	Associate	26158413, 29080283
Smith McCort Dysplasia	Inhibit	31815603
ST Elevation Myocardial Infarction	Associate	38250610
Urinary Bladder Neoplasms	Associate	21847011
Urologic Neoplasms	Associate	21847011

TCF21 (transcription factor 21)