Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6941
Gene name Gene Name - the full gene name approved by the HGNC.	Transcription factor 19
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TCF19
Synonyms (NCBI Gene) Gene synonyms aliases	SC1, TCF-19
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that contains a PHD-type zinc finger domain and likely functions as a transcription factor. The encoded protein plays a role proliferation and apoptosis of pancreatic beta cells. Alternative splicing results in multiple transcr

Show/Hide all(81)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048303	hsa-miR-107	CLASH	23622248
MIRT041802	hsa-miR-484	CLASH	23622248
MIRT439113	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439113	hsa-miR-10b-5p	3'LIFE	25074381
MIRT1416008	hsa-miR-1182	CLIP-seq
MIRT1416009	hsa-miR-1236	CLIP-seq
MIRT1416010	hsa-miR-1291	CLIP-seq
MIRT1416011	hsa-miR-3120-5p	CLIP-seq
MIRT1416012	hsa-miR-3140-5p	CLIP-seq
MIRT1416013	hsa-miR-3150a-3p	CLIP-seq
MIRT1416014	hsa-miR-3175	CLIP-seq
MIRT1416015	hsa-miR-3179	CLIP-seq
MIRT1416016	hsa-miR-3182	CLIP-seq
MIRT1416017	hsa-miR-3187-3p	CLIP-seq
MIRT1416018	hsa-miR-3194-3p	CLIP-seq
MIRT1416019	hsa-miR-3202	CLIP-seq
MIRT1416020	hsa-miR-345	CLIP-seq
MIRT1416021	hsa-miR-3907	CLIP-seq
MIRT1416022	hsa-miR-4299	CLIP-seq
MIRT1416023	hsa-miR-431	CLIP-seq
MIRT1416024	hsa-miR-4435	CLIP-seq
MIRT1416025	hsa-miR-4456	CLIP-seq
MIRT1416026	hsa-miR-4527	CLIP-seq
MIRT1416027	hsa-miR-4645-5p	CLIP-seq
MIRT1416028	hsa-miR-4667-5p	CLIP-seq
MIRT1416029	hsa-miR-4673	CLIP-seq
MIRT1416030	hsa-miR-4700-5p	CLIP-seq
MIRT1416031	hsa-miR-4701-5p	CLIP-seq
MIRT1416032	hsa-miR-4728-5p	CLIP-seq
MIRT1416033	hsa-miR-4733-3p	CLIP-seq
MIRT1416034	hsa-miR-4747-5p	CLIP-seq
MIRT1416035	hsa-miR-4778-5p	CLIP-seq
MIRT1416036	hsa-miR-548q	CLIP-seq
MIRT1416037	hsa-miR-548s	CLIP-seq
MIRT1416038	hsa-miR-588	CLIP-seq
MIRT1416039	hsa-miR-767-3p	CLIP-seq
MIRT1416040	hsa-miR-939	CLIP-seq
MIRT1416041	hsa-miR-1273d	CLIP-seq
MIRT1416042	hsa-miR-145	CLIP-seq
MIRT1416043	hsa-miR-3180-5p	CLIP-seq
MIRT1416044	hsa-miR-4267	CLIP-seq
MIRT1416045	hsa-miR-4712-5p	CLIP-seq
MIRT1416046	hsa-miR-507	CLIP-seq
MIRT1416047	hsa-miR-557	CLIP-seq
MIRT1416048	hsa-miR-766	CLIP-seq
MIRT1416049	hsa-miR-770-5p	CLIP-seq
MIRT2124793	hsa-miR-1322	CLIP-seq
MIRT2124794	hsa-miR-1343	CLIP-seq
MIRT2124795	hsa-miR-3074-5p	CLIP-seq
MIRT2124796	hsa-miR-3688-5p	CLIP-seq
MIRT2124797	hsa-miR-3689d	CLIP-seq
MIRT2124798	hsa-miR-3690	CLIP-seq
MIRT2124799	hsa-miR-4254	CLIP-seq
MIRT2124800	hsa-miR-4759	CLIP-seq
MIRT2124801	hsa-miR-4797-5p	CLIP-seq
MIRT2124802	hsa-miR-514	CLIP-seq
MIRT2124803	hsa-miR-514b-3p	CLIP-seq
MIRT2347208	hsa-miR-1224-3p	CLIP-seq
MIRT2347209	hsa-miR-1260	CLIP-seq
MIRT2347210	hsa-miR-1260b	CLIP-seq
MIRT2347211	hsa-miR-1262	CLIP-seq
MIRT2347212	hsa-miR-1280	CLIP-seq
MIRT2347213	hsa-miR-129-5p	CLIP-seq
MIRT2347214	hsa-miR-188-3p	CLIP-seq
MIRT2347215	hsa-miR-3119	CLIP-seq
MIRT2347216	hsa-miR-3156-3p	CLIP-seq
MIRT2347217	hsa-miR-3160-5p	CLIP-seq
MIRT2347218	hsa-miR-3189-3p	CLIP-seq
MIRT2347219	hsa-miR-4312	CLIP-seq
MIRT2347220	hsa-miR-4701-3p	CLIP-seq
MIRT2347221	hsa-miR-532-5p	CLIP-seq
MIRT2395586	hsa-miR-122	CLIP-seq
MIRT2395587	hsa-miR-3657	CLIP-seq
MIRT2395588	hsa-miR-4633-3p	CLIP-seq
MIRT2395589	hsa-miR-4669	CLIP-seq
MIRT2640058	hsa-miR-1301	CLIP-seq
MIRT2640059	hsa-miR-4480	CLIP-seq
MIRT2640060	hsa-miR-5047	CLIP-seq
MIRT2640058	hsa-miR-1301	CLIP-seq
MIRT2640059	hsa-miR-4480	CLIP-seq
MIRT2640060	hsa-miR-5047	CLIP-seq

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21516116, 28514442, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
600912	11629	ENSG00000137310

Protein

UniProt ID

Q9Y242

Protein name

Transcription factor 19 (TCF-19) (Transcription factor SC1)

Protein function

Potential transcription factor that may play a role in the regulation of genes involved in cell cycle G1/S transition (PubMed:1868030, PubMed:31141247). May bind to regulatory elements of genes, including the promoter of the transcription factor

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00498	FHA	31 → 105	FHA domain	Family

Sequence

MLPCFQLLRIGGGRGGDLYTFHPPAGAGCTYRLGHRADLCDVALRPQQEPGLISGIHAEL
HAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFM
FQQVRVKPQDFAAITIPRSRGEARVGAGFRPMLPSQGAPQRPLSTFSPAPKATLILNSIG
SLSKLRPQPLTFSPSWGGPKSLPVPAPPGEMGTTPSAPPQRNRRKSVHRVLAELDDESEP
PENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYPVSAPMAPPAVGGGEPCAAPCCCLP
QEETVAWVQCDGCDVWFHVACVGCSIQAAREADFRCPGCRAGIQT

Sequence length

345

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes, Type 2 diabetes (adjusted for BMI), Type 2 diabetes or schizophrenia (pleiotropy)	N/A	N/A	GWAS

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinogenesis	Associate	36233194
Carcinoma Hepatocellular	Associate	24987808, 31746185
Carcinoma Non Small Cell Lung	Associate	1645569, 31746185
Colorectal Neoplasms	Stimulate	32016966
Diabetes Mellitus Type 1	Associate	29042441, 31746185
Diabetes Mellitus Type 2	Associate	25799151, 29042441
Hearing Loss	Associate	33713422
Hepatitis B Chronic	Associate	24987808
Multiple Myeloma	Associate	27718532
Myasthenia Gravis	Associate	23055271
Neoplasm Metastasis	Associate	32016966
Neoplasms	Inhibit	11706063
Small Cell Lung Carcinoma	Associate	1645569
Stomach Neoplasms	Inhibit	11706063

TCF19 (transcription factor 19)