Gene Gene information from NCBI Gene database.
Entrez ID 6939
Gene name Transcription factor 15
Gene symbol TCF15
Synonyms (NCBI Gene)
EC2PARAXISbHLHa40
Chromosome 20
Chromosome location 20p13
Summary The protein encoded by this gene is found in the nucleus and may be involved in the early transcriptional regulation of patterning of the mesoderm. The encoded basic helix-loop-helix protein requires dimerization with another basic helix-loop-helix protei
miRNA miRNA information provided by mirtarbase database.
82
miRTarBase ID miRNA Experiments Reference
MIRT612166 hsa-miR-8485 HITS-CLIP 23824327
MIRT612165 hsa-miR-329-3p HITS-CLIP 23824327
MIRT612164 hsa-miR-362-3p HITS-CLIP 23824327
MIRT612163 hsa-miR-603 HITS-CLIP 23824327
MIRT612162 hsa-miR-10a-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
45
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601010 11627 ENSG00000125878
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q12870
Protein name Transcription factor 15 (TCF-15) (Class A basic helix-loop-helix protein 40) (bHLHa40) (Paraxis) (Protein bHLH-EC2)
Protein function Early transcription factor that plays a key role in somitogenesis, paraxial mesoderm development and regulation of stem cell pluripotency. Essential for the mesenchymal to epithelial transition associated with somite formation. Required for somi
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 73 125 Helix-loop-helix DNA-binding domain Domain
Sequence
MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRGPGPGGGRRAG
GGGGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETVRLASSY
IAHLA
NVLLLGDSADDGQPCFRAAGSAKGAVPAAADGGRQPRSICTFCLSNQRKGGGRRD
LGGSCLKVRGVAPLRGPRR
Sequence length 199
Interactions View interactions