Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6939
Gene name Gene Name - the full gene name approved by the HGNC.
Transcription factor 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TCF15
Synonyms (NCBI Gene) Gene synonyms aliases
EC2, PARAXIS, bHLHa40
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p13
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is found in the nucleus and may be involved in the early transcriptional regulation of patterning of the mesoderm. The encoded basic helix-loop-helix protein requires dimerization with another basic helix-loop-helix protei
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT612166 hsa-miR-8485 HITS-CLIP 23824327
MIRT612165 hsa-miR-329-3p HITS-CLIP 23824327
MIRT612164 hsa-miR-362-3p HITS-CLIP 23824327
MIRT612163 hsa-miR-603 HITS-CLIP 23824327
MIRT612162 hsa-miR-10a-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601010 11627 ENSG00000125878
Protein
UniProt ID Q12870
Protein name Transcription factor 15 (TCF-15) (Class A basic helix-loop-helix protein 40) (bHLHa40) (Paraxis) (Protein bHLH-EC2)
Protein function Early transcription factor that plays a key role in somitogenesis, paraxial mesoderm development and regulation of stem cell pluripotency. Essential for the mesenchymal to epithelial transition associated with somite formation. Required for somi
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 73 125 Helix-loop-helix DNA-binding domain Domain
Sequence
MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRGPGPGGGRRAG
GGGGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETVRLASSY
IAHLA
NVLLLGDSADDGQPCFRAAGSAKGAVPAAADGGRQPRSICTFCLSNQRKGGGRRD
LGGSCLKVRGVAPLRGPRR
Sequence length 199
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Triglyceride levels in non-type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Colorectal Neoplasms Associate 34526059