Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6929
Gene name	Transcription factor 3
Gene symbol	TCF3
Synonyms (NCBI Gene)	AGM8AGM8AAGM8BE2AE47ITF1TCF-3VDIRbHLHb21p75
Chromosome	19
Chromosome location	19p13.3
Summary	This gene encodes a member of the E protein (class I) family of helix-loop-helix transcription factors. E proteins activate transcription by binding to regulatory E-box sequences on target genes as heterodimers or homodimers, and are inhibited by heterodi

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs879255271	C>T	Pathogenic	Downstream transcript variant, missense variant, intron variant, coding sequence variant, genic downstream transcript variant, non coding transcript variant
rs1599413207	C>T	Likely-pathogenic	Downstream transcript variant, genic downstream transcript variant, non coding transcript variant, coding sequence variant, missense variant, intron variant

384

Show/Hide all (384)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007321	hsa-miR-17-5p	Luciferase reporter assay	23492770
MIRT007321	hsa-miR-17-5p	Luciferase reporter assay	23492770
MIRT007321	hsa-miR-17-5p	Luciferase reporter assay	23492770
MIRT023195	hsa-miR-124-3p	Microarray	18668037
MIRT044472	hsa-miR-320a	CLASH	23622248
MIRT043732	hsa-miR-342-3p	CLASH	23622248
MIRT040470	hsa-miR-615-3p	CLASH	23622248
MIRT726348	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT726349	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT726347	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT726346	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT732252	hsa-miR-506-3p	Luciferase reporter assayqRT-PCR	27538704
MIRT732252	hsa-miR-506-3p	Luciferase reporter assayqRT-PCR	27538704
MIRT1416177	hsa-miR-103a	CLIP-seq
MIRT1416178	hsa-miR-107	CLIP-seq
MIRT1416179	hsa-miR-1228	CLIP-seq
MIRT1416180	hsa-miR-1254	CLIP-seq
MIRT1416181	hsa-miR-1269	CLIP-seq
MIRT1416182	hsa-miR-1269b	CLIP-seq
MIRT1416183	hsa-miR-1275	CLIP-seq
MIRT1416184	hsa-miR-1288	CLIP-seq
MIRT1416185	hsa-miR-1304	CLIP-seq
MIRT1416186	hsa-miR-137	CLIP-seq
MIRT1416187	hsa-miR-138	CLIP-seq
MIRT1416188	hsa-miR-139-5p	CLIP-seq
MIRT1416189	hsa-miR-15a	CLIP-seq
MIRT1416190	hsa-miR-15b	CLIP-seq
MIRT1416191	hsa-miR-16	CLIP-seq
MIRT1416192	hsa-miR-1827	CLIP-seq
MIRT1416193	hsa-miR-190	CLIP-seq
MIRT1416194	hsa-miR-190b	CLIP-seq
MIRT1416195	hsa-miR-195	CLIP-seq
MIRT1416196	hsa-miR-221	CLIP-seq
MIRT1416197	hsa-miR-222	CLIP-seq
MIRT1416198	hsa-miR-2278	CLIP-seq
MIRT1416199	hsa-miR-2355-5p	CLIP-seq
MIRT1416200	hsa-miR-300	CLIP-seq
MIRT1416201	hsa-miR-3116	CLIP-seq
MIRT1416202	hsa-miR-3119	CLIP-seq
MIRT1416203	hsa-miR-3129-3p	CLIP-seq
MIRT1416204	hsa-miR-3154	CLIP-seq
MIRT1416205	hsa-miR-3163	CLIP-seq
MIRT1416206	hsa-miR-3176	CLIP-seq
MIRT1416207	hsa-miR-3191	CLIP-seq
MIRT1416208	hsa-miR-324-5p	CLIP-seq
MIRT1416209	hsa-miR-331-3p	CLIP-seq
MIRT1416210	hsa-miR-338-3p	CLIP-seq
MIRT1416211	hsa-miR-340	CLIP-seq
MIRT1416212	hsa-miR-3613-3p	CLIP-seq
MIRT1416213	hsa-miR-3618	CLIP-seq
MIRT1416214	hsa-miR-3622a-3p	CLIP-seq
MIRT1416215	hsa-miR-3622b-3p	CLIP-seq
MIRT1416216	hsa-miR-3662	CLIP-seq
MIRT1416217	hsa-miR-3665	CLIP-seq
MIRT1416218	hsa-miR-3689a-5p	CLIP-seq
MIRT1416219	hsa-miR-3689b	CLIP-seq
MIRT1416220	hsa-miR-3689e	CLIP-seq
MIRT1416221	hsa-miR-3689f	CLIP-seq
MIRT1416222	hsa-miR-3690	CLIP-seq
MIRT1416223	hsa-miR-3692	CLIP-seq
MIRT1416224	hsa-miR-3714	CLIP-seq
MIRT1416225	hsa-miR-378	CLIP-seq
MIRT1416226	hsa-miR-378b	CLIP-seq
MIRT1416227	hsa-miR-378c	CLIP-seq
MIRT1416228	hsa-miR-378d	CLIP-seq
MIRT1416229	hsa-miR-378e	CLIP-seq
MIRT1416230	hsa-miR-378f	CLIP-seq
MIRT1416231	hsa-miR-378h	CLIP-seq
MIRT1416232	hsa-miR-378i	CLIP-seq
MIRT1416233	hsa-miR-381	CLIP-seq
MIRT1416234	hsa-miR-3914	CLIP-seq
MIRT1416235	hsa-miR-3921	CLIP-seq
MIRT1416236	hsa-miR-3922-3p	CLIP-seq
MIRT1416237	hsa-miR-3944-5p	CLIP-seq
MIRT1416238	hsa-miR-409-3p	CLIP-seq
MIRT1416239	hsa-miR-422a	CLIP-seq
MIRT1416240	hsa-miR-424	CLIP-seq
MIRT1416241	hsa-miR-4264	CLIP-seq
MIRT1416242	hsa-miR-4271	CLIP-seq
MIRT1416243	hsa-miR-4278	CLIP-seq
MIRT1416244	hsa-miR-4281	CLIP-seq
MIRT1416245	hsa-miR-4282	CLIP-seq
MIRT1416246	hsa-miR-4307	CLIP-seq
MIRT1416247	hsa-miR-4310	CLIP-seq
MIRT1416248	hsa-miR-4328	CLIP-seq
MIRT1416249	hsa-miR-4330	CLIP-seq
MIRT1416250	hsa-miR-4421	CLIP-seq
MIRT1416251	hsa-miR-4427	CLIP-seq
MIRT1416252	hsa-miR-4435	CLIP-seq
MIRT1416253	hsa-miR-4436a	CLIP-seq
MIRT1416254	hsa-miR-4456	CLIP-seq
MIRT1416255	hsa-miR-4462	CLIP-seq
MIRT1416256	hsa-miR-4488	CLIP-seq
MIRT1416257	hsa-miR-4497	CLIP-seq
MIRT1416258	hsa-miR-4515	CLIP-seq
MIRT1416259	hsa-miR-4523	CLIP-seq
MIRT1416260	hsa-miR-4525	CLIP-seq
MIRT1416261	hsa-miR-4642	CLIP-seq
MIRT1416262	hsa-miR-4653-5p	CLIP-seq
MIRT1416263	hsa-miR-4658	CLIP-seq
MIRT1416264	hsa-miR-4665-5p	CLIP-seq
MIRT1416265	hsa-miR-4666-3p	CLIP-seq
MIRT1416266	hsa-miR-4680-3p	CLIP-seq
MIRT1416267	hsa-miR-4697-5p	CLIP-seq
MIRT1416268	hsa-miR-4700-3p	CLIP-seq
MIRT1416269	hsa-miR-4716-3p	CLIP-seq
MIRT1416270	hsa-miR-4720-5p	CLIP-seq
MIRT1416271	hsa-miR-4723-5p	CLIP-seq
MIRT1416272	hsa-miR-4725-3p	CLIP-seq
MIRT1416273	hsa-miR-4740-5p	CLIP-seq
MIRT1416274	hsa-miR-4755-3p	CLIP-seq
MIRT1416275	hsa-miR-4758-5p	CLIP-seq
MIRT1416276	hsa-miR-4765	CLIP-seq
MIRT1416277	hsa-miR-4766-5p	CLIP-seq
MIRT1416278	hsa-miR-4780	CLIP-seq
MIRT1416279	hsa-miR-4786-3p	CLIP-seq
MIRT1416280	hsa-miR-4786-5p	CLIP-seq
MIRT1416281	hsa-miR-4789-5p	CLIP-seq
MIRT1416282	hsa-miR-4793-5p	CLIP-seq
MIRT1416283	hsa-miR-4799-3p	CLIP-seq
MIRT1416284	hsa-miR-485-5p	CLIP-seq
MIRT1416285	hsa-miR-486-3p	CLIP-seq
MIRT1416286	hsa-miR-497	CLIP-seq
MIRT1416287	hsa-miR-512-3p	CLIP-seq
MIRT1416288	hsa-miR-520d-5p	CLIP-seq
MIRT1416289	hsa-miR-524-5p	CLIP-seq
MIRT1416290	hsa-miR-526b	CLIP-seq
MIRT1416291	hsa-miR-548aa	CLIP-seq
MIRT1416292	hsa-miR-548ac	CLIP-seq
MIRT1416293	hsa-miR-548an	CLIP-seq
MIRT1416294	hsa-miR-548d-3p	CLIP-seq
MIRT1416295	hsa-miR-548v	CLIP-seq
MIRT1416296	hsa-miR-548z	CLIP-seq
MIRT1416297	hsa-miR-563	CLIP-seq
MIRT1416298	hsa-miR-583	CLIP-seq
MIRT1416299	hsa-miR-587	CLIP-seq
MIRT1416300	hsa-miR-593	CLIP-seq
MIRT1416301	hsa-miR-598	CLIP-seq
MIRT1416302	hsa-miR-602	CLIP-seq
MIRT1416303	hsa-miR-622	CLIP-seq
MIRT1416304	hsa-miR-625	CLIP-seq
MIRT1416305	hsa-miR-637	CLIP-seq
MIRT1416306	hsa-miR-643	CLIP-seq
MIRT1416307	hsa-miR-646	CLIP-seq
MIRT1416308	hsa-miR-657	CLIP-seq
MIRT1416309	hsa-miR-671-5p	CLIP-seq
MIRT1416310	hsa-miR-922	CLIP-seq
MIRT1416311	hsa-miR-934	CLIP-seq
MIRT1416312	hsa-miR-1915	CLIP-seq
MIRT1416313	hsa-miR-199a-5p	CLIP-seq
MIRT1416314	hsa-miR-199b-5p	CLIP-seq
MIRT1416315	hsa-miR-296-5p	CLIP-seq
MIRT1416316	hsa-miR-3130-5p	CLIP-seq
MIRT1416317	hsa-miR-3174	CLIP-seq
MIRT1416222	hsa-miR-3690	CLIP-seq
MIRT1416318	hsa-miR-3918	CLIP-seq
MIRT1416319	hsa-miR-4254	CLIP-seq
MIRT1416320	hsa-miR-4270	CLIP-seq
MIRT1416321	hsa-miR-4300	CLIP-seq
MIRT1416322	hsa-miR-4441	CLIP-seq
MIRT1416323	hsa-miR-4481	CLIP-seq
MIRT1416324	hsa-miR-4482	CLIP-seq
MIRT1416325	hsa-miR-4536	CLIP-seq
MIRT1416326	hsa-miR-4685-5p	CLIP-seq
MIRT1416269	hsa-miR-4716-3p	CLIP-seq
MIRT1416327	hsa-miR-4717-5p	CLIP-seq
MIRT1416271	hsa-miR-4723-5p	CLIP-seq
MIRT1416328	hsa-miR-4745-5p	CLIP-seq
MIRT1416275	hsa-miR-4758-5p	CLIP-seq
MIRT1416329	hsa-miR-597	CLIP-seq
MIRT1416330	hsa-miR-711	CLIP-seq
MIRT1416331	hsa-miR-920	CLIP-seq
MIRT1416332	hsa-miR-939	CLIP-seq
MIRT1416179	hsa-miR-1228	CLIP-seq
MIRT2124831	hsa-miR-1262	CLIP-seq
MIRT2124832	hsa-miR-1273g	CLIP-seq
MIRT2124833	hsa-miR-1282	CLIP-seq
MIRT2124834	hsa-miR-1291	CLIP-seq
MIRT2124835	hsa-miR-129-5p	CLIP-seq
MIRT1416185	hsa-miR-1304	CLIP-seq
MIRT1416187	hsa-miR-138	CLIP-seq
MIRT1416189	hsa-miR-15a	CLIP-seq
MIRT1416190	hsa-miR-15b	CLIP-seq
MIRT1416191	hsa-miR-16	CLIP-seq
MIRT1416192	hsa-miR-1827	CLIP-seq
MIRT1416193	hsa-miR-190	CLIP-seq
MIRT1416194	hsa-miR-190b	CLIP-seq
MIRT1416312	hsa-miR-1915	CLIP-seq
MIRT1416195	hsa-miR-195	CLIP-seq
MIRT2124836	hsa-miR-24	CLIP-seq
MIRT2124837	hsa-miR-297	CLIP-seq
MIRT1416200	hsa-miR-300	CLIP-seq
MIRT1416202	hsa-miR-3119	CLIP-seq
MIRT2124838	hsa-miR-3150a-3p	CLIP-seq
MIRT2124839	hsa-miR-3175	CLIP-seq
MIRT1416207	hsa-miR-3191	CLIP-seq
MIRT1416208	hsa-miR-324-5p	CLIP-seq
MIRT2124840	hsa-miR-328	CLIP-seq
MIRT1416213	hsa-miR-3618	CLIP-seq
MIRT1416214	hsa-miR-3622a-3p	CLIP-seq
MIRT1416215	hsa-miR-3622b-3p	CLIP-seq
MIRT2124841	hsa-miR-3660	CLIP-seq
MIRT1416218	hsa-miR-3689a-5p	CLIP-seq
MIRT1416219	hsa-miR-3689b	CLIP-seq
MIRT1416220	hsa-miR-3689e	CLIP-seq
MIRT1416221	hsa-miR-3689f	CLIP-seq
MIRT1416223	hsa-miR-3692	CLIP-seq
MIRT1416233	hsa-miR-381	CLIP-seq
MIRT1416234	hsa-miR-3914	CLIP-seq
MIRT1416235	hsa-miR-3921	CLIP-seq
MIRT1416240	hsa-miR-424	CLIP-seq
MIRT1416241	hsa-miR-4264	CLIP-seq
MIRT1416245	hsa-miR-4282	CLIP-seq
MIRT2124842	hsa-miR-4283	CLIP-seq
MIRT2124843	hsa-miR-4299	CLIP-seq
MIRT1416246	hsa-miR-4307	CLIP-seq
MIRT1416249	hsa-miR-4330	CLIP-seq
MIRT1416250	hsa-miR-4421	CLIP-seq
MIRT1416251	hsa-miR-4427	CLIP-seq
MIRT1416253	hsa-miR-4436a	CLIP-seq
MIRT2124844	hsa-miR-4437	CLIP-seq
MIRT2124845	hsa-miR-4452	CLIP-seq
MIRT1416254	hsa-miR-4456	CLIP-seq
MIRT1416255	hsa-miR-4462	CLIP-seq
MIRT2124846	hsa-miR-4506	CLIP-seq
MIRT2124847	hsa-miR-4526	CLIP-seq
MIRT1416261	hsa-miR-4642	CLIP-seq
MIRT1416262	hsa-miR-4653-5p	CLIP-seq
MIRT1416263	hsa-miR-4658	CLIP-seq
MIRT2124848	hsa-miR-4659a-3p	CLIP-seq
MIRT2124849	hsa-miR-4659b-3p	CLIP-seq
MIRT1416265	hsa-miR-4666-3p	CLIP-seq
MIRT2124850	hsa-miR-4667-5p	CLIP-seq
MIRT2124851	hsa-miR-4676-5p	CLIP-seq
MIRT1416266	hsa-miR-4680-3p	CLIP-seq
MIRT2124852	hsa-miR-4691-5p	CLIP-seq
MIRT1416268	hsa-miR-4700-3p	CLIP-seq
MIRT2124853	hsa-miR-4700-5p	CLIP-seq
MIRT2124854	hsa-miR-4701-3p	CLIP-seq
MIRT2124855	hsa-miR-4707-5p	CLIP-seq
MIRT2124856	hsa-miR-4726-3p	CLIP-seq
MIRT2124857	hsa-miR-4728-5p	CLIP-seq
MIRT1416274	hsa-miR-4755-3p	CLIP-seq
MIRT1416275	hsa-miR-4758-5p	CLIP-seq
MIRT1416276	hsa-miR-4765	CLIP-seq
MIRT1416277	hsa-miR-4766-5p	CLIP-seq
MIRT1416278	hsa-miR-4780	CLIP-seq
MIRT1416282	hsa-miR-4793-5p	CLIP-seq
MIRT1416286	hsa-miR-497	CLIP-seq
MIRT2124858	hsa-miR-520g	CLIP-seq
MIRT2124859	hsa-miR-520h	CLIP-seq
MIRT1416290	hsa-miR-526b	CLIP-seq
MIRT1416291	hsa-miR-548aa	CLIP-seq
MIRT2124860	hsa-miR-548q	CLIP-seq
MIRT2124861	hsa-miR-567	CLIP-seq
MIRT2124862	hsa-miR-570	CLIP-seq
MIRT2124863	hsa-miR-575	CLIP-seq
MIRT1416298	hsa-miR-583	CLIP-seq
MIRT1416299	hsa-miR-587	CLIP-seq
MIRT1416300	hsa-miR-593	CLIP-seq
MIRT1416301	hsa-miR-598	CLIP-seq
MIRT1416302	hsa-miR-602	CLIP-seq
MIRT1416303	hsa-miR-622	CLIP-seq
MIRT2124864	hsa-miR-634	CLIP-seq
MIRT1416305	hsa-miR-637	CLIP-seq
MIRT2124865	hsa-miR-873	CLIP-seq
MIRT1416310	hsa-miR-922	CLIP-seq
MIRT1416311	hsa-miR-934	CLIP-seq
MIRT1416332	hsa-miR-939	CLIP-seq
MIRT2124866	hsa-miR-942	CLIP-seq
MIRT2124867	hsa-miR-944	CLIP-seq
MIRT1416177	hsa-miR-103a	CLIP-seq
MIRT1416178	hsa-miR-107	CLIP-seq
MIRT2347253	hsa-miR-1207-5p	CLIP-seq
MIRT1416179	hsa-miR-1228	CLIP-seq
MIRT2347254	hsa-miR-1292	CLIP-seq
MIRT1416186	hsa-miR-137	CLIP-seq
MIRT1416188	hsa-miR-139-5p	CLIP-seq
MIRT1416189	hsa-miR-15a	CLIP-seq
MIRT1416190	hsa-miR-15b	CLIP-seq
MIRT1416191	hsa-miR-16	CLIP-seq
MIRT1416193	hsa-miR-190	CLIP-seq
MIRT1416194	hsa-miR-190b	CLIP-seq
MIRT2347255	hsa-miR-1912	CLIP-seq
MIRT1416312	hsa-miR-1915	CLIP-seq
MIRT1416195	hsa-miR-195	CLIP-seq
MIRT2347256	hsa-miR-205	CLIP-seq
MIRT1416196	hsa-miR-221	CLIP-seq
MIRT1416197	hsa-miR-222	CLIP-seq
MIRT1416200	hsa-miR-300	CLIP-seq
MIRT1416205	hsa-miR-3163	CLIP-seq
MIRT1416208	hsa-miR-324-5p	CLIP-seq
MIRT2347257	hsa-miR-361-3p	CLIP-seq
MIRT2347258	hsa-miR-3622a-5p	CLIP-seq
MIRT2347259	hsa-miR-362-5p	CLIP-seq
MIRT1416216	hsa-miR-3662	CLIP-seq
MIRT1416218	hsa-miR-3689a-5p	CLIP-seq
MIRT1416219	hsa-miR-3689b	CLIP-seq
MIRT1416220	hsa-miR-3689e	CLIP-seq
MIRT1416221	hsa-miR-3689f	CLIP-seq
MIRT1416223	hsa-miR-3692	CLIP-seq
MIRT1416224	hsa-miR-3714	CLIP-seq
MIRT1416233	hsa-miR-381	CLIP-seq
MIRT1416234	hsa-miR-3914	CLIP-seq
MIRT1416318	hsa-miR-3918	CLIP-seq
MIRT2347260	hsa-miR-3922-5p	CLIP-seq
MIRT1416240	hsa-miR-424	CLIP-seq
MIRT1416241	hsa-miR-4264	CLIP-seq
MIRT1416320	hsa-miR-4270	CLIP-seq
MIRT1416244	hsa-miR-4281	CLIP-seq
MIRT1416246	hsa-miR-4307	CLIP-seq
MIRT1416249	hsa-miR-4330	CLIP-seq
MIRT2347261	hsa-miR-4423-3p	CLIP-seq
MIRT1416322	hsa-miR-4441	CLIP-seq
MIRT2347262	hsa-miR-4455	CLIP-seq
MIRT1416254	hsa-miR-4456	CLIP-seq
MIRT2347263	hsa-miR-4457	CLIP-seq
MIRT1416255	hsa-miR-4462	CLIP-seq
MIRT2347264	hsa-miR-4639-5p	CLIP-seq
MIRT2347265	hsa-miR-4640-5p	CLIP-seq
MIRT1416263	hsa-miR-4658	CLIP-seq
MIRT1416265	hsa-miR-4666-3p	CLIP-seq
MIRT1416326	hsa-miR-4685-5p	CLIP-seq
MIRT2347266	hsa-miR-4688	CLIP-seq
MIRT2124856	hsa-miR-4726-3p	CLIP-seq
MIRT2347267	hsa-miR-4726-5p	CLIP-seq
MIRT2124857	hsa-miR-4728-5p	CLIP-seq
MIRT2347268	hsa-miR-4735-5p	CLIP-seq
MIRT1416274	hsa-miR-4755-3p	CLIP-seq
MIRT1416275	hsa-miR-4758-5p	CLIP-seq
MIRT2347269	hsa-miR-4763-3p	CLIP-seq
MIRT1416276	hsa-miR-4765	CLIP-seq
MIRT2347270	hsa-miR-4775	CLIP-seq
MIRT1416278	hsa-miR-4780	CLIP-seq
MIRT1416280	hsa-miR-4786-5p	CLIP-seq
MIRT1416281	hsa-miR-4789-5p	CLIP-seq
MIRT2347271	hsa-miR-4790-5p	CLIP-seq
MIRT1416285	hsa-miR-486-3p	CLIP-seq
MIRT1416286	hsa-miR-497	CLIP-seq
MIRT2347272	hsa-miR-500b	CLIP-seq
MIRT2347273	hsa-miR-502-5p	CLIP-seq
MIRT1416287	hsa-miR-512-3p	CLIP-seq
MIRT2347274	hsa-miR-514	CLIP-seq
MIRT2347275	hsa-miR-514b-3p	CLIP-seq
MIRT2347276	hsa-miR-541	CLIP-seq
MIRT1416291	hsa-miR-548aa	CLIP-seq
MIRT1416292	hsa-miR-548ac	CLIP-seq
MIRT1416293	hsa-miR-548an	CLIP-seq
MIRT1416294	hsa-miR-548d-3p	CLIP-seq
MIRT1416295	hsa-miR-548v	CLIP-seq
MIRT1416296	hsa-miR-548z	CLIP-seq
MIRT1416297	hsa-miR-563	CLIP-seq
MIRT1416299	hsa-miR-587	CLIP-seq
MIRT2347277	hsa-miR-590-3p	CLIP-seq
MIRT1416302	hsa-miR-602	CLIP-seq
MIRT2347278	hsa-miR-615-5p	CLIP-seq
MIRT1416303	hsa-miR-622	CLIP-seq
MIRT1416309	hsa-miR-671-5p	CLIP-seq
MIRT2124865	hsa-miR-873	CLIP-seq
MIRT1416310	hsa-miR-922	CLIP-seq
MIRT2124867	hsa-miR-944	CLIP-seq
MIRT1416186	hsa-miR-137	CLIP-seq
MIRT1416188	hsa-miR-139-5p	CLIP-seq
MIRT1416196	hsa-miR-221	CLIP-seq
MIRT1416197	hsa-miR-222	CLIP-seq
MIRT1416216	hsa-miR-3662	CLIP-seq
MIRT1416223	hsa-miR-3692	CLIP-seq
MIRT1416257	hsa-miR-4497	CLIP-seq
MIRT1416287	hsa-miR-512-3p	CLIP-seq
MIRT1416295	hsa-miR-548v	CLIP-seq
MIRT2124834	hsa-miR-1291	CLIP-seq
MIRT2124840	hsa-miR-328	CLIP-seq
MIRT2124843	hsa-miR-4299	CLIP-seq
MIRT1416254	hsa-miR-4456	CLIP-seq
MIRT2124860	hsa-miR-548q	CLIP-seq
MIRT1416301	hsa-miR-598	CLIP-seq
MIRT1416200	hsa-miR-300	CLIP-seq
MIRT1416212	hsa-miR-3613-3p	CLIP-seq
MIRT1416233	hsa-miR-381	CLIP-seq
MIRT1416245	hsa-miR-4282	CLIP-seq
MIRT1416255	hsa-miR-4462	CLIP-seq
MIRT1416265	hsa-miR-4666-3p	CLIP-seq
MIRT1416281	hsa-miR-4789-5p	CLIP-seq
MIRT1416302	hsa-miR-602	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
FIGLA	Unknown	18499083
ID3	Repression	24492847
LDB1	Repression	10767331
LEF1	Unknown	8479911
LMX1B	Activation	10767331

Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	14576336
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	21828274
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IDA	10652346
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	11802795
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	14576336
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IC	21828274
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	14576336
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	10652346, 10775504, 11802795, 14752053, 15509787
GO:0002326	Process	B cell lineage commitment	IDA	15030778
GO:0002326	Process	B cell lineage commitment	NAS	12435739
GO:0003677	Function	DNA binding	IDA	2503252
GO:0003677	Function	DNA binding	IDA	8759016, 10958665
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	2105528, 11509675, 12435739
GO:0003700	Function	DNA-binding transcription factor activity	NAS	2493990
GO:0005515	Function	Protein binding	IPI	7568177, 8759016, 10652346, 10749989, 10915743, 10958665, 11248247, 11940670, 12435739, 14752053, 19321746, 19497860, 21179004, 21828274, 25009770, 25416956, 25466284, 31696227, 32296183, 32814053, 33961781, 35140242
GO:0005634	Component	Nucleus	IDA	10749989, 10775504, 12435739, 12493738, 21828274, 31696227
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	2493990
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IDA	2503252, 10775504, 15044608
GO:0005737	Component	Cytoplasm	IDA	12435739, 21828274
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	2493990
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030183	Process	B cell differentiation	NAS	12435739
GO:0030890	Process	Positive regulation of B cell proliferation	IMP	11509675
GO:0031435	Function	Mitogen-activated protein kinase kinase kinase binding	IPI	19801649
GO:0032991	Component	Protein-containing complex	IDA	12435739
GO:0033152	Process	Immunoglobulin V(D)J recombination	IBA
GO:0033152	Process	Immunoglobulin V(D)J recombination	IDA	16428437
GO:0042803	Function	Protein homodimerization activity	IDA	8759016, 10958665, 14752053
GO:0042803	Function	Protein homodimerization activity	IPI	10652346
GO:0043425	Function	BHLH transcription factor binding	IPI	10545951, 10749989, 10775504, 11802795, 21828274
GO:0045666	Process	Positive regulation of neuron differentiation	ISS
GO:0045787	Process	Positive regulation of cell cycle	IDA	11509675
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	2105528, 11509675, 12435739
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16428437
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10652346, 10775504, 11802795, 15509787, 16043483, 19362560
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	31696227
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046982	Function	Protein heterodimerization activity	IDA	14752053
GO:0046982	Function	Protein heterodimerization activity	IPI	10545951
GO:0046983	Function	Protein dimerization activity	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	14752053
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	10652346
GO:0070644	Function	Vitamin D response element binding	IDA	17426122
GO:0070888	Function	E-box binding	IDA	10775504
GO:0070888	Function	E-box binding	IDA	7933101, 10652346
GO:0070888	Function	E-box binding	IPI	15044608
GO:0070888	Function	E-box binding	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	10545951, 11802795
GO:0140297	Function	DNA-binding transcription factor binding	IPI	2503252, 12493738, 15044608, 21828274
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IDA	11509675

MIM	HGNC	e!Ensembl
147141	11633	ENSG00000071564

P15923

Protein name

Transcription factor E2-alpha (Class B basic helix-loop-helix protein 21) (bHLHb21) (Immunoglobulin enhancer-binding factor E12/E47) (Immunoglobulin transcription factor 1) (Kappa-E2-binding factor) (Transcription factor 3) (TCF-3) (Transcription factor I

Protein function

Transcriptional regulator involved in the initiation of neuronal differentiation and mesenchymal to epithelial transition (By similarity). Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles in d

PDB

2MH0 , 2YPA , 2YPB , 3U5V , 6MGN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	550 → 603	Helix-loop-helix DNA-binding domain	Domain

Sequence

MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWG
SGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGL
TQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGL
PSSVYPPSSGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPML
GGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGAT
YGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSP
QGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLP
GHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPD
SYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPP
EQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVIL
NLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM

Sequence length

654

Interactions

View interactions

	KEGG		Reactome
	Signaling pathways regulating pluripotency of stem cells Human T-cell leukemia virus 1 infection Transcriptional misregulation in cancer		Myogenesis RUNX1 regulates transcription of genes involved in differentiation of HSCs

175

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Agammaglobulinemia 8, autosomal dominant	Pathogenic	rs879255271, rs2061880735	RCV000211091 RCV001262287
Agammaglobulinemia 8b, autosomal recessive	Pathogenic	rs2146131822	RCV002221970
Multiple myeloma	Likely pathogenic	rs1599413207	RCV000984089

Show/Hide Unknown Diseases (27)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Uncertain significance; Benign	rs369551101, rs2302419, rs114650053, rs41275842	RCV005911250 RCV005914943 RCV005934862 RCV005912292
Adrenocortical carcinoma, hereditary	Benign	rs1140828, rs41275842	RCV005909561 RCV005912296
Castleman-Kojima disease	Uncertain significance	rs1369361815	RCV000824693
Cervical cancer	Benign; Likely benign	rs114650053, rs144425988, rs41275842	RCV005934863 RCV005910467 RCV005912297
Cholangiocarcinoma	Benign	rs114650053, rs41275842	RCV005934868 RCV005912309
Clear cell carcinoma of kidney	Benign	rs114650053, rs41275842	RCV005934864 RCV005912298
Colon adenocarcinoma	Benign	rs1140828, rs41275842	RCV005909560 RCV005912291
Colorectal cancer	Benign	rs1140828, rs41275842	RCV005909564 RCV005912301
Familial cancer of breast	Likely benign; Uncertain significance	rs774147274, rs756170287	RCV005926005 RCV005935057
Familial prostate cancer	Benign	rs114650053	RCV005934865
Gastric cancer	Benign	rs2302419, rs41275842	RCV005914946 RCV005912303
Hepatocellular carcinoma	Benign	rs2302419, rs41275842	RCV005914944 RCV005912293
Lung cancer	Benign	rs2302419, rs114650053, rs41275842	RCV005914948 RCV005934869 RCV005912310
Malignant lymphoma, large B-cell, diffuse	Benign	rs1140828, rs2302419, rs41275842	RCV005909563 RCV005914945 RCV005912300
Malignant tumor of esophagus	Benign	rs41275842	RCV005912294
Melanoma	Benign	rs114650053, rs41275842	RCV005934867 RCV005912308
Myeloproliferative neoplasm, unclassifiable	Conflicting classifications of pathogenicity; Benign; Uncertain significance	rs2074888, rs1052692, rs537417919, rs759917180, rs1445581828, rs551790548	RCV002284219 RCV002284220 RCV002284229 RCV002284267 RCV002284268 RCV002284269
Nonpapillary renal cell carcinoma	Benign	rs41275842	RCV005912295
Ovarian serous cystadenocarcinoma	Benign; Uncertain significance	rs2302419, rs2240590, rs41275842	RCV005914947 RCV005925529 RCV005912304
Sarcoma	Benign	rs41275842	RCV005912302
See cases	Uncertain significance	rs1186803096	RCV002252566
TCF3-related disorder	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	rs372296344, rs370087169, rs372168347, rs748162352, rs367960890, rs146126608, rs76459051, rs80338425, rs35936626, rs34203855, rs200307903, rs200168957, rs370129424, rs1471157814, rs371323214 View all (35 more)	RCV003416252 RCV004753294 RCV003946022 RCV003946033 RCV003953753 RCV003948549 RCV003948496 RCV003956185 RCV003931081 RCV003911161 RCV003892955 RCV003426282 RCV003941252 RCV003984157 RCV004753439 RCV003903520 RCV003951226 RCV003903499 RCV003903503 RCV003895947 RCV003916720 RCV003898439 RCV004753574 RCV003936330 RCV003395554 RCV004753651 RCV003410198 RCV003400334 RCV003392888 RCV004753711 RCV003902147 RCV003904165 RCV003983308 RCV003978315 RCV004753149 RCV003935971 RCV003920655 RCV003940564 RCV003975612 RCV003910623 RCV003977927 RCV003940823 RCV004753101 RCV003913068 RCV003970421 RCV004753154 RCV003411941 RCV003918639 RCV003928657 RCV003973180 RCV003918821
Thymoma	Benign	rs114650053, rs41275842	RCV005934866 RCV005912306
Thyroid cancer, nonmedullary, 1	Benign	rs41275842	RCV005912307
Uterine carcinosarcoma	Benign	rs1140828, rs41275842	RCV005909565 RCV005912305
Uterine corpus endometrial carcinoma	Benign	rs114650053, rs41275842	RCV005934870 RCV005912311
Uveal melanoma	Benign	rs1140828, rs41275842	RCV005909562 RCV005912299

Show/Hide Text Mining Associations (91)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	33833226
Adenocarcinoma in Situ	Associate	23688269
Adenoviridae Infections	Associate	10846061
Agammaglobulinemia	Associate	24216514
Anemia Diamond Blackfan	Associate	9292545
Aortic Aneurysm Abdominal	Inhibit	37721971
Breast Neoplasms	Associate	34700372, 36829181
Bronchiectasis	Associate	40703516
Burkitt Lymphoma	Associate	22885699, 26437030, 26468873, 26567765, 26712879, 28209658, 30567752, 32449435, 40572059
Burkitt Lymphoma	Stimulate	34658308
Carcinogenesis	Associate	30894657, 37607071
Carcinogenesis	Inhibit	34037532
Carcinoma Basal Cell	Associate	14633602
Carcinoma Hepatocellular	Associate	20331628
Carcinoma Non Small Cell Lung	Associate	23688269
Carcinoma Renal Cell	Associate	24228124, 27461063, 31486487
Carcinoma Squamous Cell	Stimulate	28604457
Carcinoma Squamous Cell	Associate	33833226
Central Nervous System Diseases	Associate	19282835
Chromosome 17 trisomy	Associate	1516826, 20519628
Chromosome Disorders	Associate	32245383
Colorectal Neoplasms	Associate	23940558, 24369055, 24454819, 25375219, 25659031, 32737302
Common Variable Immunodeficiency	Associate	26081581, 40703516
Desmoid disease hereditary	Associate	11437409
Disease	Associate	12580965
Drug Related Side Effects and Adverse Reactions	Associate	19138562
Edema	Associate	33663097
Episodic Kinesigenic Dyskinesia 2	Associate	10500199, 1671560, 17593026, 37704696, 7910944
Episodic Kinesigenic Dyskinesia 2	Stimulate	19101069
Esophageal Squamous Cell Carcinoma	Associate	37607071
Fibromatosis Aggressive	Associate	11437409
Fibrosis	Associate	16814783, 24516231, 38303515
Gastro enteropancreatic neuroendocrine tumor	Associate	34037532
Genetic Diseases Inborn	Associate	19553647
Glaucoma Open Angle	Associate	36727359
Glioma	Associate	36231068, 40653505
Hematologic Diseases	Associate	15182431
Hematologic Neoplasms	Associate	38303515
Hepatitis B	Associate	23107779, 27461063
Hereditary Angioedema Type III	Stimulate	11398990
Hereditary leiomyomatosis and renal cell cancer	Associate	16877363, 27166193
Hodgkin Disease	Associate	27166193
Idiopathic Pulmonary Fibrosis	Associate	18478089
Infections	Associate	32184235
Inflammation	Inhibit	37721971
Kidney Neoplasms	Associate	24516231, 34278464
Leukemia	Associate	11369863, 12086872, 19101069, 21536647, 22972988, 24454819, 25137060, 25266309, 28651627, 30894657, 31735627, 33542097, 34597466, 36943767, 7910944, 8159721, 8639829, 9927512 View all (3 more)
Leukemia	Stimulate	14536079
Leukemia B Cell	Associate	19282835, 32029838
Leukemia Biphenotypic Acute	Associate	15801954, 19138562, 24990612, 32150610, 32378810, 33164984, 33890726, 34406703, 37981088
Leukemia Erythroblastic Acute	Associate	9525934
Leukemia Lymphoid	Associate	14536079
Leukemia Myeloid	Stimulate	7910944
Leukemia Myeloid Acute	Associate	10500199, 23091311, 27632978, 30894657, 8327485
Leukemia T Cell	Associate	25499232
Lung Neoplasms	Associate	28592245
Lymphatic Diseases	Associate	22994759
Lymphoma	Associate	16782810, 17272506, 21788410, 24369055, 34658308
Lymphoma B Cell	Associate	28209658, 34260910, 34553842
Lymphoma B Cell Marginal Zone	Associate	20802470
Lymphoma Large B Cell Diffuse	Associate	22517897, 28479318
Lymphoma Primary Effusion	Associate	17456056
Lymphoma T Cell	Associate	17272506, 21788410
Neoplasm Metastasis	Associate	24369055, 25375219, 34700372
Neoplasm Metastasis	Inhibit	34037532
Neoplasms	Associate	11437409, 19138562, 21655267, 22564737, 23688269, 24454819, 27701467, 34700372, 35065254, 35587604, 37019972, 37607071, 39228892, 40653505
Neoplasms	Inhibit	14536079, 21788410
Neoplasms	Stimulate	33833226
Neuroblastoma	Associate	16705184, 23135478
Optic Nerve Hypoplasia	Associate	31696227
Parkinson Disease	Associate	26510930
Philadelphia Chromosome	Associate	36124444
Polycythemia Vera	Inhibit	38303515
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	10500199, 1967982, 22911440, 23107779, 24578304, 25137060, 25273558, 27461063, 28063722, 30487223, 31575852, 35092653, 36124444, 36233173, 7910944, 8704188 View all (1 more)
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	12415113, 12580965, 1348433, 1516826, 1520867, 1671560, 19101069, 19922767, 20564080, 22911440, 22972988, 23107779, 23148371, 24578304, 25273558 View all (22 more)
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	15801954, 17593026, 19138562, 24990612, 25499232, 32245383, 33663097, 34549416, 35001521, 36550642, 9927512
Prehypertension	Associate	10500199, 19282835
Primary Myelofibrosis	Inhibit	38303515
Prostatic Neoplasms	Associate	22564737, 27701467
Renal Insufficiency	Associate	33960101
Rhabdomyosarcoma	Associate	19299559
Sarcoma Alveolar Soft Part	Associate	32127467
Sezary Syndrome	Associate	21788410
Stomach Neoplasms	Associate	34700372, 35065254, 37100457
Tarlov Cysts	Associate	25375219
Tetra amelia with ectodermal dysplasia and lacrimal duct abnormalities	Associate	10979974
Uterine Cervical Neoplasms	Associate	28604457, 35587604
Varicella Zoster Virus Infection	Associate	36439222
Virus Diseases	Associate	15681431
Waldenstrom Macroglobulinemia	Associate	32457988
Wilms Tumor	Associate	34278464

TCF3 (transcription factor 3)