ELOC (elongin C)

Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6921
Gene name Gene Name - the full gene name approved by the HGNC.
Elongin C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ELOC
Synonyms (NCBI Gene) Gene synonyms aliases
SIII, TCEB1
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q21.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymera
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
SNP ID Visualize variation Clinical significance Consequence
rs1057519973 T>A,G Likely-pathogenic Missense variant, coding sequence variant
rs1057519974 A>T Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(153)
miRTarBase ID miRNA Experiments Reference
MIRT616179 hsa-miR-106a-5p HITS-CLIP 23824327
MIRT616178 hsa-miR-106b-5p HITS-CLIP 23824327
MIRT616177 hsa-miR-17-5p HITS-CLIP 23824327
MIRT616176 hsa-miR-20a-5p HITS-CLIP 23824327
MIRT616175 hsa-miR-20b-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(15)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 10205047, 10851083, 12004076, 12050673, 12149480, 15590694, 15601820, 16189514, 16643902, 17183367, 19159283, 19322197, 19327355, 21145461, 21199876, 21516116, 21988832, 22190034, 23563313, 25416956, 31515488, 31980649, 32296183
GO:0005654 Component Nucleoplasm TAS
GO:0005829 Component Cytosol TAS
GO:0006357 Process Regulation of transcription by RNA polymerase II TAS 7660129
GO:0006366 Process Transcription by RNA polymerase II TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
600788 11617 ENSG00000154582
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q15369
Protein name Elongin-C (EloC) (Elongin 15 kDa subunit) (RNA polymerase II transcription factor SIII subunit C) (SIII p15) (Transcription elongation factor B polypeptide 1)
Protein function SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity i
PDB 1LM8 , 1LQB , 1VCB , 2C9W , 2IZV , 2MA9 , 3DCG , 3ZKJ , 3ZNG , 3ZRC , 3ZRF , 3ZTC , 3ZTD , 3ZUN , 4AJY , 4AWJ , 4B95 , 4B9K , 4BKS , 4BKT , 4N9F , 4W9C , 4W9D , 4W9E , 4W9F , 4W9G , 4W9H , 4W9I , 4W9J , 4W9K , 4W9L , 4WQO , 5BO4 , 5LLI , 5N4W , 5NVV , 5NVW , 5NVX , 5NVY , 5NVZ , 5NW0 , 5NW1 , 5NW2 , 5T35 , 6BVB , 6C5X , 6FMI , 6FMJ , 6FMK , 6GFX , 6GFY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03931 Skp1_POZ 17 → 82 Skp1 family, tetramerisation domain Domain
Tissue specificity TISSUE SPECIFICITY: Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3. {ECO:0000269|PubMed:12004003}.
Sequence 
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Sequence length 112
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  HIF-1 signaling pathway
Ubiquitin mediated proteolysis
Human immunodeficiency virus 1 infection
Pathways in cancer
Renal cell carcinoma 		  Formation of RNA Pol II elongation complex
Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Vif-mediated degradation of APOBEC3G
RNA Polymerase II Pre-transcription Events
TP53 Regulates Transcription of DNA Repair Genes
RNA Polymerase II Transcription Elongation
Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Papillary renal carcinoma Papillary Renal Cell Carcinoma rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724 23797736
Renal carcinoma Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney rs121913668, rs121913670, rs121913243, rs786202724 26619011, 23797736
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Chromophobe carcinoma Chromophobe Renal Cell Carcinoma 23797736 ClinVar
Show/Hide Text Mining Associations (14)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 12004003, 20139910
Carcinoma Renal Cell Associate 24821879, 25676555, 28731045, 31813809, 32251007, 34512202, 35323939, 37088333, 37964489
Hypoxia Associate 9447969
Hypoxia Brain Associate 35323939
Kidney Neoplasms Associate 37088333
Melanoma Associate 36753617
Neoplasm Metastasis Associate 34163032
Neoplasms Associate 24821879, 25676555, 34163032, 37964489
Neoplasms Inhibit 31813809
Personality Disorders Associate 31813809