Gene Gene information from NCBI Gene database.
Entrez ID 6921
Gene name Elongin C
Gene symbol ELOC
Synonyms (NCBI Gene)
SIIITCEB1
Chromosome 8
Chromosome location 8q21.11
Summary This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymera
SNPs SNP information provided by dbSNP.
2
SNP ID Visualize variation Clinical significance Consequence
rs1057519973 T>A,G Likely-pathogenic Missense variant, coding sequence variant
rs1057519974 A>T Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
153
miRTarBase ID miRNA Experiments Reference
MIRT616179 hsa-miR-106a-5p HITS-CLIP 23824327
MIRT616178 hsa-miR-106b-5p HITS-CLIP 23824327
MIRT616177 hsa-miR-17-5p HITS-CLIP 23824327
MIRT616176 hsa-miR-20a-5p HITS-CLIP 23824327
MIRT616175 hsa-miR-20b-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IEA
GO:0001222 Function Transcription corepressor binding IPI 7660122
GO:0005515 Function Protein binding IPI 10205047, 10851083, 12004076, 12050673, 12149480, 15590694, 15601820, 16189514, 16643902, 17183367, 19159283, 19322197, 19327355, 20211142, 21119685, 21145461, 21199876, 21516116, 21822215, 21988832, 22190034, 22510880, 23460923, 23563313, 25416956, 28514442, 31515488, 31980649, 322
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600788 11617 ENSG00000154582
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15369
Protein name Elongin-C (EloC) (Elongin 15 kDa subunit) (RNA polymerase II transcription factor SIII subunit C) (SIII p15) (Transcription elongation factor B polypeptide 1)
Protein function SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity i
PDB 1LM8 , 1LQB , 1VCB , 2C9W , 2IZV , 2MA9 , 3DCG , 3ZKJ , 3ZNG , 3ZRC , 3ZRF , 3ZTC , 3ZTD , 3ZUN , 4AJY , 4AWJ , 4B95 , 4B9K , 4BKS , 4BKT , 4N9F , 4W9C , 4W9D , 4W9E , 4W9F , 4W9G , 4W9H , 4W9I , 4W9J , 4W9K , 4W9L , 4WQO , 5BO4 , 5LLI , 5N4W , 5NVV , 5NVW , 5NVX , 5NVY , 5NVZ , 5NW0 , 5NW1 , 5NW2 , 5T35 , 6BVB , 6C5X , 6FMI , 6FMJ , 6FMK , 6GFX , 6GFY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03931 Skp1_POZ 17 82 Skp1 family, tetramerisation domain Domain
Tissue specificity TISSUE SPECIFICITY: Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3. {ECO:0000269|PubMed:12004003}.
Sequence
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVR
YTNSSTEIPEFPIAPEIALELLMAANFLDC
Sequence length 112
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  HIF-1 signaling pathway
Ubiquitin mediated proteolysis
Human immunodeficiency virus 1 infection
Pathways in cancer
Renal cell carcinoma
  Formation of RNA Pol II elongation complex
Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Vif-mediated degradation of APOBEC3G
RNA Polymerase II Pre-transcription Events
TP53 Regulates Transcription of DNA Repair Genes
RNA Polymerase II Transcription Elongation
Neddylation
Antigen processing: Ubiquitination & Proteasome degradation