Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6908
Gene name Gene Name - the full gene name approved by the HGNC.	TATA-box binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TBP
Synonyms (NCBI Gene) Gene synonyms aliases	GTF2D, GTF2D1, HDL4, SCA17, TBP1, TFIID
Disease Acronyms (UniProt) Disease acronyms from UniProt database	SCA17
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q27
Summary Summary of gene provided in NCBI Entrez Gene.	Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,

Show/Hide all(191)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051286	hsa-miR-16-5p	CLASH	23622248
MIRT040014	hsa-miR-615-3p	CLASH	23622248
MIRT734136	hsa-miR-613	Western blotting, Immunofluorescence, qRT-PCR	32943930
MIRT1414826	hsa-miR-1206	CLIP-seq
MIRT1414827	hsa-miR-1273g	CLIP-seq
MIRT1414828	hsa-miR-2110	CLIP-seq
MIRT1414829	hsa-miR-3148	CLIP-seq
MIRT1414830	hsa-miR-3163	CLIP-seq
MIRT1414831	hsa-miR-3529	CLIP-seq
MIRT1414832	hsa-miR-379	CLIP-seq
MIRT1414833	hsa-miR-4271	CLIP-seq
MIRT1414834	hsa-miR-4318	CLIP-seq
MIRT1414835	hsa-miR-4451	CLIP-seq
MIRT1414836	hsa-miR-4490	CLIP-seq
MIRT1414837	hsa-miR-4650-3p	CLIP-seq
MIRT1414838	hsa-miR-4668-5p	CLIP-seq
MIRT1414839	hsa-miR-4725-3p	CLIP-seq
MIRT1414840	hsa-miR-4774-5p	CLIP-seq
MIRT1414841	hsa-miR-548a-3p	CLIP-seq
MIRT1414842	hsa-miR-548ac	CLIP-seq
MIRT1414843	hsa-miR-548ae	CLIP-seq
MIRT1414844	hsa-miR-548aj	CLIP-seq
MIRT1414845	hsa-miR-548am	CLIP-seq
MIRT1414846	hsa-miR-548d-3p	CLIP-seq
MIRT1414847	hsa-miR-548e	CLIP-seq
MIRT1414848	hsa-miR-548f	CLIP-seq
MIRT1414849	hsa-miR-548g	CLIP-seq
MIRT1414850	hsa-miR-548x	CLIP-seq
MIRT1414851	hsa-miR-548z	CLIP-seq
MIRT1414852	hsa-miR-1	CLIP-seq
MIRT1414853	hsa-miR-1231	CLIP-seq
MIRT1414854	hsa-miR-1243	CLIP-seq
MIRT1414855	hsa-miR-128	CLIP-seq
MIRT1414856	hsa-miR-148a	CLIP-seq
MIRT1414857	hsa-miR-148b	CLIP-seq
MIRT1414858	hsa-miR-152	CLIP-seq
MIRT1414859	hsa-miR-15a	CLIP-seq
MIRT1414860	hsa-miR-15b	CLIP-seq
MIRT1414861	hsa-miR-16	CLIP-seq
MIRT1414862	hsa-miR-185	CLIP-seq
MIRT1414863	hsa-miR-195	CLIP-seq
MIRT1414864	hsa-miR-200b	CLIP-seq
MIRT1414865	hsa-miR-200c	CLIP-seq
MIRT1414866	hsa-miR-206	CLIP-seq
MIRT1414867	hsa-miR-2117	CLIP-seq
MIRT1414868	hsa-miR-2277-5p	CLIP-seq
MIRT1414869	hsa-miR-27a	CLIP-seq
MIRT1414870	hsa-miR-27b	CLIP-seq
MIRT1414871	hsa-miR-3128	CLIP-seq
MIRT1414872	hsa-miR-3654	CLIP-seq
MIRT1414873	hsa-miR-3673	CLIP-seq
MIRT1414874	hsa-miR-424	CLIP-seq
MIRT1414875	hsa-miR-4264	CLIP-seq
MIRT1414876	hsa-miR-4273	CLIP-seq
MIRT1414877	hsa-miR-429	CLIP-seq
MIRT1414878	hsa-miR-4306	CLIP-seq
MIRT1414879	hsa-miR-4479	CLIP-seq
MIRT1414880	hsa-miR-4524	CLIP-seq
MIRT1414881	hsa-miR-4644	CLIP-seq
MIRT1414882	hsa-miR-4668-3p	CLIP-seq
MIRT1414883	hsa-miR-4694-3p	CLIP-seq
MIRT1414884	hsa-miR-4704-3p	CLIP-seq
MIRT1414885	hsa-miR-4711-3p	CLIP-seq
MIRT1414886	hsa-miR-4720-5p	CLIP-seq
MIRT1414887	hsa-miR-4778-5p	CLIP-seq
MIRT1414888	hsa-miR-4797-3p	CLIP-seq
MIRT1414889	hsa-miR-4799-3p	CLIP-seq
MIRT1414890	hsa-miR-497	CLIP-seq
MIRT1414891	hsa-miR-503	CLIP-seq
MIRT1414892	hsa-miR-522	CLIP-seq
MIRT1414893	hsa-miR-556-5p	CLIP-seq
MIRT1414894	hsa-miR-646	CLIP-seq
MIRT1414895	hsa-miR-885-3p	CLIP-seq
MIRT1414826	hsa-miR-1206	CLIP-seq
MIRT1414827	hsa-miR-1273g	CLIP-seq
MIRT1414828	hsa-miR-2110	CLIP-seq
MIRT1414829	hsa-miR-3148	CLIP-seq
MIRT1414833	hsa-miR-4271	CLIP-seq
MIRT1414834	hsa-miR-4318	CLIP-seq
MIRT1414838	hsa-miR-4668-5p	CLIP-seq
MIRT1414839	hsa-miR-4725-3p	CLIP-seq
MIRT1414852	hsa-miR-1	CLIP-seq
MIRT1414853	hsa-miR-1231	CLIP-seq
MIRT1414854	hsa-miR-1243	CLIP-seq
MIRT1414855	hsa-miR-128	CLIP-seq
MIRT1414856	hsa-miR-148a	CLIP-seq
MIRT1414857	hsa-miR-148b	CLIP-seq
MIRT1414858	hsa-miR-152	CLIP-seq
MIRT1414859	hsa-miR-15a	CLIP-seq
MIRT1414860	hsa-miR-15b	CLIP-seq
MIRT1414861	hsa-miR-16	CLIP-seq
MIRT1414862	hsa-miR-185	CLIP-seq
MIRT1414863	hsa-miR-195	CLIP-seq
MIRT1414864	hsa-miR-200b	CLIP-seq
MIRT1414865	hsa-miR-200c	CLIP-seq
MIRT1414866	hsa-miR-206	CLIP-seq
MIRT1414867	hsa-miR-2117	CLIP-seq
MIRT1414868	hsa-miR-2277-5p	CLIP-seq
MIRT1414869	hsa-miR-27a	CLIP-seq
MIRT1414870	hsa-miR-27b	CLIP-seq
MIRT1414871	hsa-miR-3128	CLIP-seq
MIRT2346736	hsa-miR-324-5p	CLIP-seq
MIRT1414872	hsa-miR-3654	CLIP-seq
MIRT1414873	hsa-miR-3673	CLIP-seq
MIRT2346737	hsa-miR-371-5p	CLIP-seq
MIRT2346738	hsa-miR-421	CLIP-seq
MIRT1414874	hsa-miR-424	CLIP-seq
MIRT1414875	hsa-miR-4264	CLIP-seq
MIRT1414876	hsa-miR-4273	CLIP-seq
MIRT2346739	hsa-miR-4287	CLIP-seq
MIRT1414877	hsa-miR-429	CLIP-seq
MIRT1414878	hsa-miR-4306	CLIP-seq
MIRT2346740	hsa-miR-4469	CLIP-seq
MIRT1414879	hsa-miR-4479	CLIP-seq
MIRT2346741	hsa-miR-4519	CLIP-seq
MIRT1414880	hsa-miR-4524	CLIP-seq
MIRT1414881	hsa-miR-4644	CLIP-seq
MIRT2346742	hsa-miR-4653-3p	CLIP-seq
MIRT2346743	hsa-miR-4685-3p	CLIP-seq
MIRT1414884	hsa-miR-4704-3p	CLIP-seq
MIRT2346744	hsa-miR-4709-5p	CLIP-seq
MIRT1414885	hsa-miR-4711-3p	CLIP-seq
MIRT2346745	hsa-miR-4713-5p	CLIP-seq
MIRT1414886	hsa-miR-4720-5p	CLIP-seq
MIRT1414887	hsa-miR-4778-5p	CLIP-seq
MIRT1414888	hsa-miR-4797-3p	CLIP-seq
MIRT1414889	hsa-miR-4799-3p	CLIP-seq
MIRT1414890	hsa-miR-497	CLIP-seq
MIRT1414891	hsa-miR-503	CLIP-seq
MIRT2346746	hsa-miR-505	CLIP-seq
MIRT1414893	hsa-miR-556-5p	CLIP-seq
MIRT2346747	hsa-miR-561	CLIP-seq
MIRT1414894	hsa-miR-646	CLIP-seq
MIRT1414895	hsa-miR-885-3p	CLIP-seq
MIRT1414826	hsa-miR-1206	CLIP-seq
MIRT1414827	hsa-miR-1273g	CLIP-seq
MIRT1414828	hsa-miR-2110	CLIP-seq
MIRT1414829	hsa-miR-3148	CLIP-seq
MIRT1414830	hsa-miR-3163	CLIP-seq
MIRT2639357	hsa-miR-340	CLIP-seq
MIRT1414831	hsa-miR-3529	CLIP-seq
MIRT1414832	hsa-miR-379	CLIP-seq
MIRT1414833	hsa-miR-4271	CLIP-seq
MIRT2639358	hsa-miR-4282	CLIP-seq
MIRT1414834	hsa-miR-4318	CLIP-seq
MIRT1414835	hsa-miR-4451	CLIP-seq
MIRT1414836	hsa-miR-4490	CLIP-seq
MIRT1414837	hsa-miR-4650-3p	CLIP-seq
MIRT2346742	hsa-miR-4653-3p	CLIP-seq
MIRT1414838	hsa-miR-4668-5p	CLIP-seq
MIRT1414839	hsa-miR-4725-3p	CLIP-seq
MIRT1414840	hsa-miR-4774-5p	CLIP-seq
MIRT1414841	hsa-miR-548a-3p	CLIP-seq
MIRT1414842	hsa-miR-548ac	CLIP-seq
MIRT1414843	hsa-miR-548ae	CLIP-seq
MIRT1414844	hsa-miR-548aj	CLIP-seq
MIRT1414845	hsa-miR-548am	CLIP-seq
MIRT1414846	hsa-miR-548d-3p	CLIP-seq
MIRT1414847	hsa-miR-548e	CLIP-seq
MIRT1414848	hsa-miR-548f	CLIP-seq
MIRT1414849	hsa-miR-548g	CLIP-seq
MIRT1414850	hsa-miR-548x	CLIP-seq
MIRT1414851	hsa-miR-548z	CLIP-seq
MIRT1414826	hsa-miR-1206	CLIP-seq
MIRT1414827	hsa-miR-1273g	CLIP-seq
MIRT1414828	hsa-miR-2110	CLIP-seq
MIRT1414829	hsa-miR-3148	CLIP-seq
MIRT1414830	hsa-miR-3163	CLIP-seq
MIRT2639357	hsa-miR-340	CLIP-seq
MIRT1414831	hsa-miR-3529	CLIP-seq
MIRT1414832	hsa-miR-379	CLIP-seq
MIRT1414833	hsa-miR-4271	CLIP-seq
MIRT1414834	hsa-miR-4318	CLIP-seq
MIRT1414835	hsa-miR-4451	CLIP-seq
MIRT1414836	hsa-miR-4490	CLIP-seq
MIRT1414837	hsa-miR-4650-3p	CLIP-seq
MIRT2346742	hsa-miR-4653-3p	CLIP-seq
MIRT1414838	hsa-miR-4668-5p	CLIP-seq
MIRT1414839	hsa-miR-4725-3p	CLIP-seq
MIRT1414840	hsa-miR-4774-5p	CLIP-seq
MIRT1414841	hsa-miR-548a-3p	CLIP-seq
MIRT1414842	hsa-miR-548ac	CLIP-seq
MIRT1414843	hsa-miR-548ae	CLIP-seq
MIRT1414844	hsa-miR-548aj	CLIP-seq
MIRT1414845	hsa-miR-548am	CLIP-seq
MIRT1414846	hsa-miR-548d-3p	CLIP-seq
MIRT1414847	hsa-miR-548e	CLIP-seq
MIRT1414848	hsa-miR-548f	CLIP-seq
MIRT1414849	hsa-miR-548g	CLIP-seq
MIRT1414850	hsa-miR-548x	CLIP-seq
MIRT1414851	hsa-miR-548z	CLIP-seq

Transcription factors

Show/Hide all(14)

Transcription factor	Regulation	Reference
AR	Unknown	9238003
BTAF1	Repression	20627952
BTAF1	Unknown	14988402;15509807;16858867
CDX1	Unknown	17158164
CREM	Unknown	10409662
DR1	Repression	16858867
DR1	Unknown	8670811
DRAP1	Unknown	15509807
GTF2A1	Unknown	12818428
HNF4A	Unknown	19805548
NFKB1	Unknown	9023117
RELA	Activation	7706261
RELA	Unknown	9023117
TAF1	Unknown	16858867

Show/Hide all(47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	24289924
GO:0000791	Component	Euchromatin	IDA	19861239
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	7933101, 9027316, 16540471
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000979	Function	RNA polymerase II core promoter sequence-specific DNA binding	IDA	29111974
GO:0000995	Function	RNA polymerase III general transcription initiation factor activity	IMP	26638071
GO:0001046	Function	Core promoter sequence-specific DNA binding	IDA	9841876
GO:0001091	Function	RNA polymerase II general transcription initiation factor binding	IPI	8670811, 29111974
GO:0001093	Function	TFIIB-class transcription factor binding	IPI	9841876
GO:0001103	Function	RNA polymerase II repressing transcription factor binding	IEA
GO:0001939	Component	Female pronucleus	IEA
GO:0001940	Component	Male pronucleus	IEA
GO:0005515	Function	Protein binding	IPI	1465435, 7667268, 7680771, 7724559, 7729427, 7799929, 8006019, 8504927, 8626665, 9045704, 9603525, 9674425, 9748258, 10391676, 10567391, 10619841, 11029584, 11438666, 12040021, 12217962, 12552007, 15207618, 16641295, 17158164, 17268553, 17318177, 17884155, 18391197, 24418534, 2649661
GO:0005634	Component	Nucleus	IDA	9841876, 27007846
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005669	Component	Transcription factor TFIID complex	IDA	7729427, 14580349, 27007846, 27193682, 29111974
GO:0005672	Component	Transcription factor TFIIA complex	IDA	7724559
GO:0005737	Component	Cytoplasm	IEA
GO:0006352	Process	DNA-templated transcription, initiation	IBA	21873635
GO:0006361	Process	Transcription initiation from RNA polymerase I promoter	TAS
GO:0006362	Process	Transcription elongation from RNA polymerase I promoter	TAS
GO:0006363	Process	Termination of RNA polymerase I transcription	TAS
GO:0006366	Process	Transcription by RNA polymerase II	IC	7729427
GO:0006366	Process	Transcription by RNA polymerase II	IDA	7724559
GO:0006366	Process	Transcription by RNA polymerase II	IMP	27193682
GO:0006366	Process	Transcription by RNA polymerase II	TAS
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	IC	7729427
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0006383	Process	Transcription by RNA polymerase III	IDA	9027316
GO:0006383	Process	Transcription by RNA polymerase III	IMP	26638071
GO:0007283	Process	Spermatogenesis	IEA
GO:0008134	Function	Transcription factor binding	IPI	7724559, 8626665, 9722567, 11005381, 12676957
GO:0016032	Process	Viral process	IEA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IBA	21873635
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IDA	9841876, 27193682
GO:0017162	Function	Aryl hydrocarbon receptor binding	IPI	15641800
GO:0019899	Function	Enzyme binding	IPI	25336585
GO:0032991	Component	Protein-containing complex	IMP	15641800
GO:0042795	Process	SnRNA transcription by RNA polymerase II	TAS
GO:0045815	Process	Positive regulation of gene expression, epigenetic	TAS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IDA	9841876
GO:0070491	Function	Repressing transcription factor binding	IPI	18838386
GO:0097550	Component	Transcription preinitiation complex	IDA	9841876
GO:0140223	Function	General transcription initiation factor activity	IBA	21873635
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS

MIM	HGNC	e!Ensembl
600075	11588	ENSG00000112592

Protein

UniProt ID

P20226

Protein name

TATA-box-binding protein (TATA sequence-binding protein) (TATA-binding factor) (TATA-box factor) (Transcription initiation factor TFIID TBP subunit)

Protein function

The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (PubMed:33795473). TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TAT

PDB

1C9B , 1CDW , 1JFI , 1NVP , 1TGH , 4ROC , 4ROD , 4ROE , 5FUR , 5IY6 , 5IY7 , 5IY8 , 5IY9 , 5IYA , 5IYB , 5IYC , 5IYD , 5N9G , 6MZD , 6MZL , 6MZM , 6O9L , 7EDX , 7EG7 , 7EG8 , 7EG9 , 7EGA , 7EGB , 7EGC , 7EGD , 7EGE , 7EGF , 7EGI , 7EGJ , 7ENA , 7ENC , 7LBM , 7NVR , 7NVS , 7NVT , 7NVU , 7NVY , 7NVZ , 7NW0 , 7ZWC , 7ZWD , 7ZX7 , 7ZX8 , 7ZXE , 8BVW , 8BYQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00352	TBP	162 → 244	Transcription factor TFIID (or TATA-binding protein, TBP)	Domain
PF00352	TBP	252 → 335	Transcription factor TFIID (or TATA-binding protein, TBP)	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with levels highest in the testis and ovary. {ECO:0000269|PubMed:17570761}.

Sequence

MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQ
LFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDL
KTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV
VQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRI
VLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT

Sequence length

339

Interactions

View interactions

	KEGG		Reactome
	Basal transcription factors Huntington disease Spinocerebellar ataxia Human papillomavirus infection Human T-cell leukemia virus 1 infection Viral carcinogenesis		B-WICH complex positively regulates rRNA expression RNA Polymerase II Pre-transcription Events Regulation of TP53 Activity through Phosphorylation RNA polymerase II transcribes snRNA genes RNA Polymerase I Transcription Initiation RNA Polymerase I Promoter Escape RNA Polymerase II Promoter Escape RNA Polymerase II Transcription Pre-Initiation And Promoter Opening RNA Polymerase I Transcription Termination RNA Polymerase II Transcription Initiation RNA Polymerase II Transcription Initiation And Promoter Clearance RNA Polymerase III Transcription Initiation From Type 1 Promoter RNA Polymerase III Transcription Initiation From Type 2 Promoter RNA Polymerase III Transcription Initiation From Type 3 Promoter Estrogen-dependent gene expression

Show/Hide Causal Diseases (5)

Disease term	Disease name	dbSNP ID	References
Causal
Apraxia	Apraxias	rs121908377, rs121908378, rs1135401820, rs1178491246, rs1584969672
Nystagmus	Nystagmus, End-Position	rs137852207, rs137852208, rs1928435502, rs137852209, rs137852210, rs1929191668, rs137852211, rs137852212, rs2124209414, rs387906720, rs387906721, rs1602791884, rs786205896
Parkinson disease	Parkinsonian Disorders, PARKINSON DISEASE, LATE-ONSET	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432 View all (84 more)
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	19566714, 16054804
Spinocerebellar ataxia	SPINOCEREBELLAR ATAXIA 17, Spinocerebellar ataxia type 17	rs80356538, rs80356539, rs56144125, rs28937887, rs80356544, rs80356540, rs80356542, rs1941485201, rs121918306, rs151344520, rs151344519, rs151344521, rs151344523, rs151344512, rs193922926 View all (203 more)

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Depressive disorder			ClinVar

Show/Hide Text Mining Associations (75)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	37694353
Adenocarcinoma of Lung	Associate	36261009
Adenoma	Stimulate	28415573
Aging Premature	Associate	35069971
Amyotrophic Lateral Sclerosis	Associate	23424617
Anodontia	Associate	37894839
Arthritis Rheumatoid	Associate	37894839
Asthma Chronic Obstructive Pulmonary Disease Overlap Syndrome	Associate	15147363
Astrocytoma	Associate	20511187
Ataxia	Associate	15989694
Atherosclerosis	Associate	32033288, 37240358
Autoimmune Diseases	Associate	32033288
beta Thalassemia	Associate	40197981
Breast Neoplasms	Associate	18211679, 39408874, 39838295
Breast Neoplasms Male	Associate	26694100
Carcinogenesis	Associate	18567809, 28415573
Carcinoma Hepatocellular	Associate	19200351, 23811755, 37020316
Carcinoma Non Small Cell Lung	Associate	28262749, 37694353
Carcinoma Renal Cell	Associate	17559644
Carcinoma Squamous Cell	Associate	24457517
Cardiovascular Diseases	Associate	28105927
Cerebellar Ataxia	Associate	26267067, 36476347
Chordoma	Associate	38282590
Cognition Disorders	Associate	22889412, 31522753, 36422518
Colonic Neoplasms	Associate	28415573
Colorectal Neoplasms	Associate	28415573, 32424999, 37558778
Death	Associate	36422518
Delta Beta Thalassemia	Associate	23424617
Depressive Disorder	Associate	28585930
Dystonia	Associate	32033288
Frontotemporal Dementia	Associate	37146135
Genetic Diseases Inborn	Associate	28105927, 30933216, 34906452
Glaucoma Open Angle	Associate	39684516
Glioblastoma	Associate	19257903, 34705606
Heart Diseases	Associate	22530004
Hemophilia B	Associate	23424617
Huntington Disease	Associate	18418687
Huntington Disease Like Syndrome	Associate	36476347
Hypopharyngeal Neoplasms	Associate	31173291
Hypoxia	Associate	28415573
Inflammation	Associate	26694100
Inflammatory Bowel Diseases	Associate	32424999
Laryngeal Neoplasms	Associate	31173291
Leukemia Myeloid Acute	Associate	29316424
Liposarcoma	Associate	11278855
Liver Neoplasms	Associate	34752497
Lung Neoplasms	Associate	23424617
Lupus Erythematosus Systemic	Associate	15147363
Lymphoma Large B Cell Diffuse	Associate	35069971
Machado Joseph Disease	Associate	29057148
Macrophage Activation Syndrome	Associate	32033288
Multiple System Atrophy	Associate	33502644
Myocardial Infarction	Associate	23424617
Neoplasm Metastasis	Associate	36261009
Neoplasms	Associate	18211679, 19650912, 26516624, 28415573, 33092533
Neoplasms	Inhibit	21108695
Neuroacanthocytosis	Associate	39292690
Nevus Sebaceous of Jadassohn	Associate	38247858
Obesity	Associate	26694100, 28105927
Osteoarthritis	Associate	24080205, 38247858
Ovarian Neoplasms	Associate	36978087
Parkinson Disease	Associate	39914017
Periodontitis	Associate	29116140
Personality Disorders	Associate	28105927
Prostatic Neoplasms	Associate	27700103, 8662737
Schizophrenia	Associate	19566714
Scleroderma Systemic	Stimulate	15147363
Spherocytosis Hereditary	Associate	16037067, 21071415
Spinocerebellar Ataxia 17	Associate	15989694, 18418687, 19075547, 19566714, 22530004, 22889412, 25549101, 32377295, 34171784, 34906452, 36422518, 36476347
Spinocerebellar Ataxias	Associate	24972706, 33502644, 34171784, 34565721, 39456985
Spinocerebellar Degenerations	Associate	26374734
Squamous Cell Carcinoma of Head and Neck	Associate	19650912
Thrombophlebitis	Associate	23424617
Triple Negative Breast Neoplasms	Associate	18211679
Urinary Bladder Neoplasms	Associate	33057113, 37542643

TBP (TATA-box binding protein)