Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6905
Gene name Gene Name - the full gene name approved by the HGNC.
Tubulin folding cofactor E
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TBCE
Synonyms (NCBI Gene) Gene synonyms aliases
HRD, KCS, KCS1, PEAMO, pac2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q42.3
Summary Summary of gene provided in NCBI Entrez Gene.
Cofactor E is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediate
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121908384 T>A Pathogenic Stop gained, coding sequence variant
rs139440109 C>T Conflicting-interpretations-of-pathogenicity Synonymous variant, coding sequence variant
rs141498084 T>G Conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant
rs143886167 A>G Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, 5 prime UTR variant, missense variant
rs144448831 G>A Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT042552 hsa-miR-423-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000226 Process Microtubule cytoskeleton organization IBA
GO:0000226 Process Microtubule cytoskeleton organization IEA
GO:0000226 Process Microtubule cytoskeleton organization IEA
GO:0000226 Process Microtubule cytoskeleton organization IMP 27666369
GO:0005515 Function Protein binding IPI 27666374
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604934 11582 ENSG00000284770
Protein
UniProt ID Q15813
Protein name Tubulin-specific chaperone E (Tubulin-folding cofactor E)
Protein function Tubulin-folding protein; involved in the second step of the tubulin folding pathway and in the regulation of tubulin heterodimer dissociation. Required for correct organization of microtubule cytoskeleton and mitotic splindle, and maintenance of
PDB 4ICU , 4ICV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01302 CAP_GLY 10 75 CAP-Gly domain Domain
PF14560 Ubiquitin_2 446 526 Ubiquitin-like domain Domain
Sequence
MSDTLTADVIGRRVEVNGEHATVRFAGVVPPVAGPWLGVEWDNPERGKHDGSHEGTVYFK
CRHPTGGSFIRPNKV
NFGTDFLTAIKNRYVLEDGPEEDRKEQIVTIGNKPVETIGFDSIM
KQQSQLSKLQEVSLRNCAVSCAGEKGGVAEACPNIRKVDLSKNLLSSWDEVIHIADQLRH
LEVLNVSENKLKFPSGSVLTGTLSVLKVLVLNQTGITWAEVLRCVAGCPGLEELYLESNN
IFISERPTDVLQTVKLLDLSSNQLIDENQLYLIAHLPRLEQLILSDTGISSLHFPDAGIG
CKTSMFPSLKYLVVNDNQISQWSFFNELEKLPSLRALSCLRNPLTKEDKEAETARLLIIA
SIGQLKTLNKCEILPEERRRAELDYRKAFGNEWKQAGGHKDPEKNRLSEEFLTAHPRYQF
LCLKYGAPEDWELKTQQPLMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSR
LLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDCLLVR
W
Sequence length 527
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Encephalopathy, With Amyotrophy And Optic Atrophy encephalopathy, progressive, with amyotrophy and optic atrophy rs750781063, rs780472451, rs1553336397, rs767004810 N/A
Hypoparathyroidism-retardation-dysmorphism syndrome hypoparathyroidism-retardation-dysmorphism syndrome rs121908384, rs767004810, rs1572324681 N/A
Kenny-Caffey Syndrome autosomal recessive kenny-caffey syndrome rs200356271, rs767004810 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Diffuse Brain Atrophy-Microcephaly-Muscle Weakness-Optic Atrophy Syndrome early-onset progressive diffuse brain atrophy-microcephaly-muscle weakness-optic atrophy syndrome N/A N/A GenCC
Microcephaly microcephaly N/A N/A ClinVar
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Brain Diseases Associate 29921875
Clear cell metastatic renal cell carcinoma Associate 39366934
Congenital Abnormalities Associate 36258138
Constriction Pathologic Associate 19554981
Disorders of Sex Development Associate 35432193
Facial Dysmorphism with Multiple Malformations Associate 16938882
Genetic Diseases Inborn Associate 16938882
Growth Disorders Associate 22764442
Hypoparathyroidism Associate 16938882, 22764442, 30080992, 36258138
Hypoparathyroidism retardation dysmorphism syndrome Associate 19554981, 22764442, 26336027, 30080992, 36258138