Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6901
Gene name Gene Name - the full gene name approved by the HGNC.
Tafazzin, phospholipid-lysophospholipid transacylase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TAFAZZIN
Synonyms (NCBI Gene) Gene synonyms aliases
BTHS, CMD3A, EFE, EFE2, G4.5, LVNCX, TAZ, Taz1
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq28
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocard
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs132630277 G>A Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs200909606 C>T Conflicting-interpretations-of-pathogenicity Non coding transcript variant, coding sequence variant, missense variant
rs387907218 G>A,C Pathogenic Non coding transcript variant, missense variant, coding sequence variant
rs397515746 G>A Likely-pathogenic Non coding transcript variant, missense variant, coding sequence variant
rs397515747 G>A Pathogenic Splice acceptor variant
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003841 Function 1-acylglycerol-3-phosphate O-acyltransferase activity TAS
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IDA 38322995
GO:0005739 Component Mitochondrion IDA 15304507, 19700766
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300394 11577 ENSG00000102125
Protein
UniProt ID Q16635
Protein name Tafazzin (Taz) (EC 2.3.1.-) (Protein G4.5)
Protein function Acyltransferase required to remodel newly synthesized phospholipid cardiolipin (1',3'-bis-[1,2-diacyl-sn-glycero-3-phospho]-glycerol or CL), a key component of the mitochondrial inner membrane, with tissue specific acyl chains necessary for adeq
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01553 Acyltransferase 41 215 Acyltransferase Family
Tissue specificity TISSUE SPECIFICITY: High levels in cardiac and skeletal muscle. Up to 10 isoforms can be present in different amounts in different tissues. Most isoforms are ubiquitous. Isoforms that lack the N-terminus are found in leukocytes and fibroblasts, but not in
Sequence
MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTKYMNHLTVHNREVLYELIEKRGPA
TPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVP
VCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKGDGVYQKGMDFILEKLNHGDWVHIFPE
GKVNMSSEFLRFKWGIGRLIAECHLNPIILPLWHV
GMNDVLPNSPPYFPRFGQKITVLIG
KPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR
Sequence length 292
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycerophospholipid metabolism   Mitochondrial protein import
Acyl chain remodeling of CL
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
3-Methylglutaconic aciduria 3-Methylglutaconic aciduria type 2 rs1603376833, rs794729167, rs1569552731, rs104894942, rs876661038, rs1603381671, rs876661112, rs1569552936, rs587776741, rs878853654, rs1603377945, rs387907218, rs1060500044, rs1603381860, rs1603377590
View all (18 more)
N/A
Cardiomyopathy left ventricular noncompaction cardiomyopathy, Primary dilated cardiomyopathy rs1603377936, rs387907218 N/A
cardiomyopathy Cardiomyopathy rs1569552936 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Barth Syndrome Barth syndrome N/A N/A GenCC
Hypertrophic Cardiomyopathy Primary familial hypertrophic cardiomyopathy N/A N/A ClinVar
Left ventricular noncompaction left ventricular noncompaction N/A N/A ClinVar