Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6888
Gene name Gene Name - the full gene name approved by the HGNC.	Transaldolase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TALDO1
Synonyms (NCBI Gene) Gene synonyms aliases	TAL, TAL-H, TALDOR, TALH
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.	Transaldolase 1 is a key enzyme of the nonoxidative pentose phosphate pathway providing ribose-5-phosphate for nucleic acid synthesis and NADPH for lipid biosynthesis. This pathway can also maintain glutathione at a reduced state and thus protect sulfhydr

Show/Hide all(8)

SNP ID	Visualize variation	Clinical significance	Consequence
rs137853085	CCT>-	Pathogenic	Coding sequence variant, inframe deletion
rs151052416	G>A	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs727502867	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs751425603	C>T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs753787975	G>A,T	Pathogenic	Coding sequence variant, missense variant
rs797045110	->C	Pathogenic	Frameshift variant, coding sequence variant
rs1057524714	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1590072094	->T	Likely-pathogenic	Coding sequence variant, stop gained

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048990	hsa-miR-92a-3p	CLASH	23622248
MIRT043964	hsa-miR-378a-5p	CLASH	23622248
MIRT036671	hsa-miR-935	CLASH	23622248
MIRT1410243	hsa-miR-134	CLIP-seq
MIRT1410244	hsa-miR-3118	CLIP-seq
MIRT1410245	hsa-miR-3609	CLIP-seq
MIRT1410246	hsa-miR-4282	CLIP-seq
MIRT1410247	hsa-miR-4423-3p	CLIP-seq
MIRT1410248	hsa-miR-4786-3p	CLIP-seq
MIRT1410249	hsa-miR-548ah	CLIP-seq
MIRT1410250	hsa-miR-548t	CLIP-seq
MIRT1410251	hsa-miR-590-3p	CLIP-seq
MIRT2122948	hsa-miR-1266	CLIP-seq
MIRT2122949	hsa-miR-1289	CLIP-seq
MIRT2122950	hsa-miR-3198	CLIP-seq
MIRT2122951	hsa-miR-4270	CLIP-seq
MIRT2122952	hsa-miR-4294	CLIP-seq
MIRT2122953	hsa-miR-4309	CLIP-seq
MIRT2122954	hsa-miR-4441	CLIP-seq
MIRT2122955	hsa-miR-4518	CLIP-seq
MIRT2122956	hsa-miR-516b	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
ZNF143	Unknown	14702349
ZNF76	Unknown	14702349

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004801	Function	Transaldolase activity	IBA
GO:0004801	Function	Transaldolase activity	IDA	18687684
GO:0004801	Function	Transaldolase activity	IEA
GO:0004801	Function	Transaldolase activity	IMP	18498245
GO:0004801	Function	Transaldolase activity	TAS	9524206
GO:0005515	Function	Protein binding	IPI	21044950, 25854864, 32814053
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	IDA	18498245
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0005975	Process	Carbohydrate metabolic process	TAS	9524206
GO:0006002	Process	Fructose 6-phosphate metabolic process	IEA
GO:0006098	Process	Pentose-phosphate shunt	IEA
GO:0009052	Process	Pentose-phosphate shunt, non-oxidative branch	IBA
GO:0009052	Process	Pentose-phosphate shunt, non-oxidative branch	IEA
GO:0009052	Process	Pentose-phosphate shunt, non-oxidative branch	IMP	18498245
GO:0016740	Function	Transferase activity	IEA
GO:0019682	Process	Glyceraldehyde-3-phosphate metabolic process	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0048029	Function	Monosaccharide binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145

MIM	HGNC	e!Ensembl
602063	11559	ENSG00000177156

Protein

UniProt ID

P37837

Protein name

Transaldolase (EC 2.2.1.2)

Protein function

Catalyzes the rate-limiting step of the non-oxidative phase in the pentose phosphate pathway. Catalyzes the reversible conversion of sedheptulose-7-phosphate and D-glyceraldehyde 3-phosphate into erythrose-4-phosphate and beta-D-fructose 6-phosp

PDB

1F05

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00923	TAL_FSA	24 → 326	Transaldolase/Fructose-6-phosphate aldolase	Domain

Sequence

MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQE
LVEEAIAYGRKLGGSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVA
RARRLIELYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAE
AGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRN
TGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQASDLEKIHLDEKSFRWLHNE
DQMAVEKLSDGIRKFAADAVKLERMLTERMFNAENGK

Sequence length

337

Interactions

View interactions

	KEGG		Reactome
	Pentose phosphate pathway Metabolic pathways Carbon metabolism Biosynthesis of amino acids		Insulin effects increased synthesis of Xylulose-5-Phosphate TALDO1 deficiency: failed conversion of SH7P, GA3P to Fru(6)P, E4P TALDO1 deficiency: failed conversion of Fru(6)P, E4P to SH7P, GA3P Pentose phosphate pathway Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

TALDO1 (transaldolase 1)