Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6887
Gene name Gene Name - the full gene name approved by the HGNC.
TAL bHLH transcription factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TAL2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q31.2
Summary Summary of gene provided in NCBI Entrez Gene.
This intronless gene encodes a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-c
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT723276 hsa-miR-1237-3p HITS-CLIP 19536157
MIRT723275 hsa-miR-1248 HITS-CLIP 19536157
MIRT723274 hsa-miR-130b-5p HITS-CLIP 19536157
MIRT723273 hsa-miR-3124-3p HITS-CLIP 19536157
MIRT723272 hsa-miR-627-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding TAS 1763056
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
186855 11557 ENSG00000186051
Protein
UniProt ID Q16559
Protein name T-cell acute lymphocytic leukemia protein 2 (TAL-2) (Class A basic helix-loop-helix protein 19) (bHLHa19)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 3 55 Helix-loop-helix DNA-binding domain Domain
Sequence
MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGE
QSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP
Sequence length 108
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Lymphoblastic leukemia Childhood Acute Lymphoblastic Leukemia, L2 Acute Lymphoblastic Leukemia, Precursor Cell Lymphoblastic Leukemia Lymphoma rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699
View all (13 more)
Unknown
Disease term Disease name Evidence References Source
Schizophrenia Schizophrenia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 19088038
Lung Neoplasms Associate 19088038
Precursor T Cell Lymphoblastic Leukemia Lymphoma Associate 22058201