Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6886
Gene name Gene Name - the full gene name approved by the HGNC.	TAL bHLH transcription factor 1, erythroid differentiation factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TAL1
Synonyms (NCBI Gene) Gene synonyms aliases	SCL, TCL5, bHLHa17, tal-1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p33

Show/Hide all(218)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053370	hsa-miR-9-5p	Microarray, qRT-PCR	23798388
MIRT054047	hsa-miR-223-3p	ChIP-seq, Microarray, Western blot	23857984
MIRT054047	hsa-miR-223-3p	ChIP-seq, Microarray, Western blot	23857984
MIRT054047	hsa-miR-223-3p	ChIP-seq, Microarray, Western blot	23857984
MIRT665956	hsa-miR-3121-3p	HITS-CLIP	23313552
MIRT665955	hsa-miR-8485	HITS-CLIP	23313552
MIRT665954	hsa-miR-577	HITS-CLIP	23313552
MIRT665953	hsa-miR-4719	HITS-CLIP	23313552
MIRT698711	hsa-miR-340-3p	HITS-CLIP	23313552
MIRT698710	hsa-miR-6827-3p	HITS-CLIP	23313552
MIRT665952	hsa-miR-342-3p	HITS-CLIP	23313552
MIRT684336	hsa-miR-6895-3p	HITS-CLIP	23313552
MIRT665951	hsa-miR-377-3p	HITS-CLIP	23313552
MIRT665956	hsa-miR-3121-3p	HITS-CLIP	23313552
MIRT665955	hsa-miR-8485	HITS-CLIP	23313552
MIRT665954	hsa-miR-577	HITS-CLIP	23313552
MIRT665953	hsa-miR-4719	HITS-CLIP	23313552
MIRT665952	hsa-miR-342-3p	HITS-CLIP	23313552
MIRT684336	hsa-miR-6895-3p	HITS-CLIP	23313552
MIRT665951	hsa-miR-377-3p	HITS-CLIP	23313552
MIRT665956	hsa-miR-3121-3p	HITS-CLIP	23824327
MIRT665955	hsa-miR-8485	HITS-CLIP	23824327
MIRT665954	hsa-miR-577	HITS-CLIP	23824327
MIRT665953	hsa-miR-4719	HITS-CLIP	23824327
MIRT665952	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT665951	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT665956	hsa-miR-3121-3p	HITS-CLIP	23824327
MIRT665955	hsa-miR-8485	HITS-CLIP	23824327
MIRT665954	hsa-miR-577	HITS-CLIP	23824327
MIRT665953	hsa-miR-4719	HITS-CLIP	23824327
MIRT665952	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT665951	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT563546	hsa-miR-3922-5p	PAR-CLIP	20371350
MIRT516190	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT516189	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT516188	hsa-miR-561-5p	PAR-CLIP	20371350
MIRT516187	hsa-miR-6807-5p	PAR-CLIP	20371350
MIRT516186	hsa-miR-1273e	PAR-CLIP	20371350
MIRT516190	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT516189	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT516188	hsa-miR-561-5p	PAR-CLIP	23446348
MIRT516187	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT516186	hsa-miR-1273e	PAR-CLIP	23446348
MIRT498296	hsa-miR-320a	PAR-CLIP	22291592
MIRT498295	hsa-miR-320b	PAR-CLIP	22291592
MIRT498294	hsa-miR-320c	PAR-CLIP	22291592
MIRT498293	hsa-miR-320d	PAR-CLIP	22291592
MIRT498292	hsa-miR-4429	PAR-CLIP	22291592
MIRT498291	hsa-miR-4780	PAR-CLIP	22291592
MIRT665956	hsa-miR-3121-3p	HITS-CLIP	27418678
MIRT665956	hsa-miR-3121-3p	HITS-CLIP	27418678
MIRT665953	hsa-miR-4719	HITS-CLIP	27418678
MIRT665953	hsa-miR-4719	HITS-CLIP	27418678
MIRT665954	hsa-miR-577	HITS-CLIP	27418678
MIRT665954	hsa-miR-577	HITS-CLIP	27418678
MIRT665955	hsa-miR-8485	HITS-CLIP	27418678
MIRT665955	hsa-miR-8485	HITS-CLIP	27418678
MIRT665956	hsa-miR-3121-3p	HITS-CLIP	23313552
MIRT665955	hsa-miR-8485	HITS-CLIP	23313552
MIRT665954	hsa-miR-577	HITS-CLIP	23313552
MIRT665953	hsa-miR-4719	HITS-CLIP	23313552
MIRT698711	hsa-miR-340-3p	HITS-CLIP	23313552
MIRT698710	hsa-miR-6827-3p	HITS-CLIP	23313552
MIRT665952	hsa-miR-342-3p	HITS-CLIP	23313552
MIRT684336	hsa-miR-6895-3p	HITS-CLIP	23313552
MIRT665951	hsa-miR-377-3p	HITS-CLIP	23313552
MIRT665956	hsa-miR-3121-3p	HITS-CLIP	23313552
MIRT665955	hsa-miR-8485	HITS-CLIP	23313552
MIRT665954	hsa-miR-577	HITS-CLIP	23313552
MIRT665953	hsa-miR-4719	HITS-CLIP	23313552
MIRT665952	hsa-miR-342-3p	HITS-CLIP	23313552
MIRT684336	hsa-miR-6895-3p	HITS-CLIP	23313552
MIRT665951	hsa-miR-377-3p	HITS-CLIP	23313552
MIRT665956	hsa-miR-3121-3p	HITS-CLIP	23824327
MIRT665955	hsa-miR-8485	HITS-CLIP	23824327
MIRT665954	hsa-miR-577	HITS-CLIP	23824327
MIRT665953	hsa-miR-4719	HITS-CLIP	23824327
MIRT665952	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT665951	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT665956	hsa-miR-3121-3p	HITS-CLIP	23824327
MIRT665955	hsa-miR-8485	HITS-CLIP	23824327
MIRT665954	hsa-miR-577	HITS-CLIP	23824327
MIRT665953	hsa-miR-4719	HITS-CLIP	23824327
MIRT665952	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT665951	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT563546	hsa-miR-3922-5p	PAR-CLIP	20371350
MIRT516190	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT516189	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT516188	hsa-miR-561-5p	PAR-CLIP	20371350
MIRT516187	hsa-miR-6807-5p	PAR-CLIP	20371350
MIRT516186	hsa-miR-1273e	PAR-CLIP	20371350
MIRT516190	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT516189	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT516188	hsa-miR-561-5p	PAR-CLIP	23446348
MIRT516187	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT516186	hsa-miR-1273e	PAR-CLIP	23446348
MIRT498296	hsa-miR-320a	PAR-CLIP	22291592
MIRT498295	hsa-miR-320b	PAR-CLIP	22291592
MIRT498294	hsa-miR-320c	PAR-CLIP	22291592
MIRT498293	hsa-miR-320d	PAR-CLIP	22291592
MIRT498292	hsa-miR-4429	PAR-CLIP	22291592
MIRT498291	hsa-miR-4780	PAR-CLIP	22291592
MIRT1410164	hsa-miR-1233	CLIP-seq
MIRT1410165	hsa-miR-128	CLIP-seq
MIRT1410166	hsa-miR-1285	CLIP-seq
MIRT1410167	hsa-miR-1302	CLIP-seq
MIRT1410168	hsa-miR-1324	CLIP-seq
MIRT1410169	hsa-miR-193a-5p	CLIP-seq
MIRT1410170	hsa-miR-2964a-5p	CLIP-seq
MIRT1410171	hsa-miR-299-5p	CLIP-seq
MIRT1410172	hsa-miR-3122	CLIP-seq
MIRT1410173	hsa-miR-3126-5p	CLIP-seq
MIRT1410174	hsa-miR-3153	CLIP-seq
MIRT1410175	hsa-miR-3164	CLIP-seq
MIRT1410176	hsa-miR-3166	CLIP-seq
MIRT1410177	hsa-miR-3179	CLIP-seq
MIRT1410178	hsa-miR-3187-5p	CLIP-seq
MIRT1410179	hsa-miR-3199	CLIP-seq
MIRT1410180	hsa-miR-338-3p	CLIP-seq
MIRT1410181	hsa-miR-33a	CLIP-seq
MIRT1410182	hsa-miR-33b	CLIP-seq
MIRT1410183	hsa-miR-3613-3p	CLIP-seq
MIRT1410184	hsa-miR-3675-3p	CLIP-seq
MIRT1410185	hsa-miR-377	CLIP-seq
MIRT1410186	hsa-miR-3913-5p	CLIP-seq
MIRT1410187	hsa-miR-3926	CLIP-seq
MIRT1410188	hsa-miR-3941	CLIP-seq
MIRT1410189	hsa-miR-3942-3p	CLIP-seq
MIRT1410190	hsa-miR-4257	CLIP-seq
MIRT1410191	hsa-miR-4298	CLIP-seq
MIRT1410192	hsa-miR-4307	CLIP-seq
MIRT1410193	hsa-miR-4419a	CLIP-seq
MIRT1410194	hsa-miR-4432	CLIP-seq
MIRT1410195	hsa-miR-4468	CLIP-seq
MIRT1410196	hsa-miR-448	CLIP-seq
MIRT1410197	hsa-miR-4510	CLIP-seq
MIRT1410198	hsa-miR-451b	CLIP-seq
MIRT1410199	hsa-miR-4533	CLIP-seq
MIRT1410200	hsa-miR-466	CLIP-seq
MIRT1410201	hsa-miR-4662a-5p	CLIP-seq
MIRT1410202	hsa-miR-4672	CLIP-seq
MIRT1410203	hsa-miR-4676-5p	CLIP-seq
MIRT1410204	hsa-miR-4684-5p	CLIP-seq
MIRT1410205	hsa-miR-4691-3p	CLIP-seq
MIRT1410206	hsa-miR-4696	CLIP-seq
MIRT1410207	hsa-miR-4721	CLIP-seq
MIRT1410208	hsa-miR-4740-5p	CLIP-seq
MIRT1410209	hsa-miR-4747-5p	CLIP-seq
MIRT1410210	hsa-miR-4778-3p	CLIP-seq
MIRT1410211	hsa-miR-4799-5p	CLIP-seq
MIRT1410212	hsa-miR-575	CLIP-seq
MIRT1410213	hsa-miR-612	CLIP-seq
MIRT1410214	hsa-miR-622	CLIP-seq
MIRT1410215	hsa-miR-661	CLIP-seq
MIRT1410168	hsa-miR-1324	CLIP-seq
MIRT2122936	hsa-miR-1972	CLIP-seq
MIRT2122937	hsa-miR-2116	CLIP-seq
MIRT2122938	hsa-miR-3124-3p	CLIP-seq
MIRT2122939	hsa-miR-3127-3p	CLIP-seq
MIRT1410175	hsa-miR-3164	CLIP-seq
MIRT2122940	hsa-miR-3679-3p	CLIP-seq
MIRT1410187	hsa-miR-3926	CLIP-seq
MIRT1410193	hsa-miR-4419a	CLIP-seq
MIRT2122941	hsa-miR-4477b	CLIP-seq
MIRT1410197	hsa-miR-4510	CLIP-seq
MIRT2122942	hsa-miR-4519	CLIP-seq
MIRT1410201	hsa-miR-4662a-5p	CLIP-seq
MIRT1410203	hsa-miR-4676-5p	CLIP-seq
MIRT2122943	hsa-miR-4677-5p	CLIP-seq
MIRT1410207	hsa-miR-4721	CLIP-seq
MIRT2122944	hsa-miR-4724-3p	CLIP-seq
MIRT2122945	hsa-miR-508-5p	CLIP-seq
MIRT1410212	hsa-miR-575	CLIP-seq
MIRT2122946	hsa-miR-609	CLIP-seq
MIRT2122947	hsa-miR-939	CLIP-seq
MIRT2345266	hsa-miR-1224-3p	CLIP-seq
MIRT1410166	hsa-miR-1285	CLIP-seq
MIRT1410168	hsa-miR-1324	CLIP-seq
MIRT2345267	hsa-miR-146b-3p	CLIP-seq
MIRT1410169	hsa-miR-193a-5p	CLIP-seq
MIRT2122937	hsa-miR-2116	CLIP-seq
MIRT2345268	hsa-miR-3173-5p	CLIP-seq
MIRT1410178	hsa-miR-3187-5p	CLIP-seq
MIRT2345269	hsa-miR-3908	CLIP-seq
MIRT2345270	hsa-miR-3918	CLIP-seq
MIRT1410192	hsa-miR-4307	CLIP-seq
MIRT2345271	hsa-miR-4512	CLIP-seq
MIRT1410201	hsa-miR-4662a-5p	CLIP-seq
MIRT1410203	hsa-miR-4676-5p	CLIP-seq
MIRT2345272	hsa-miR-4685-5p	CLIP-seq
MIRT2345273	hsa-miR-4786-3p	CLIP-seq
MIRT1410212	hsa-miR-575	CLIP-seq
MIRT1410213	hsa-miR-612	CLIP-seq
MIRT1410215	hsa-miR-661	CLIP-seq
MIRT2345274	hsa-miR-874	CLIP-seq
MIRT2395513	hsa-miR-3120-5p	CLIP-seq
MIRT2345270	hsa-miR-3918	CLIP-seq
MIRT2395514	hsa-miR-4802-3p	CLIP-seq
MIRT2433772	hsa-miR-129-5p	CLIP-seq
MIRT2433773	hsa-miR-197	CLIP-seq
MIRT2433774	hsa-miR-4717-3p	CLIP-seq
MIRT2433775	hsa-miR-629	CLIP-seq
MIRT1410166	hsa-miR-1285	CLIP-seq
MIRT1410178	hsa-miR-3187-5p	CLIP-seq
MIRT1410194	hsa-miR-4432	CLIP-seq
MIRT1410198	hsa-miR-451b	CLIP-seq
MIRT1410206	hsa-miR-4696	CLIP-seq
MIRT1410213	hsa-miR-612	CLIP-seq
MIRT1410215	hsa-miR-661	CLIP-seq
MIRT1410166	hsa-miR-1285	CLIP-seq
MIRT2692621	hsa-miR-3184	CLIP-seq
MIRT1410178	hsa-miR-3187-5p	CLIP-seq
MIRT2692622	hsa-miR-423-5p	CLIP-seq
MIRT1410194	hsa-miR-4432	CLIP-seq
MIRT1410198	hsa-miR-451b	CLIP-seq
MIRT2122946	hsa-miR-609	CLIP-seq
MIRT1410213	hsa-miR-612	CLIP-seq
MIRT1410215	hsa-miR-661	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
GATA1	Unknown	8058326

Show/Hide all(56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IDA	19497860
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IDA	20855495
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001085	Function	RNA polymerase II transcription factor binding	IPI	15920471
GO:0001525	Process	Angiogenesis	IEA
GO:0003682	Function	Chromatin binding	IDA	16763211
GO:0003700	Function	DNA-binding transcription factor activity	IDA	19497860
GO:0005515	Function	Protein binding	IPI	7568177, 9824680, 19497860, 20028976, 21179004, 25394790
GO:0005634	Component	Nucleus	IDA	19497860
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	15920471
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0019899	Function	Enzyme binding	IPI	19497860
GO:0021527	Process	Spinal cord association neuron differentiation	IEA
GO:0030097	Process	Hemopoiesis	ISS
GO:0030218	Process	Erythrocyte differentiation	IEP	7678994
GO:0030218	Process	Erythrocyte differentiation	IMP	1396592
GO:0030219	Process	Megakaryocyte differentiation	IEP	7678994
GO:0030220	Process	Platelet formation	IEA
GO:0030221	Process	Basophil differentiation	IEP	7678994
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	20855495
GO:0033193	Component	Lsd1/2 complex	IDA	19497860
GO:0035162	Process	Embryonic hemopoiesis	ISS
GO:0035855	Process	Megakaryocyte development	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042826	Function	Histone deacetylase binding	IPI	19497860
GO:0043249	Process	Erythrocyte maturation	IEA
GO:0045165	Process	Cell fate commitment	ISS
GO:0045647	Process	Negative regulation of erythrocyte differentiation	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IDA	20028976
GO:0045648	Process	Positive regulation of erythrocyte differentiation	ISS
GO:0045799	Process	Positive regulation of chromatin assembly or disassembly	IMP	20855495
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	20028976
GO:0045931	Process	Positive regulation of mitotic cell cycle	IMP	20855495
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20855495
GO:0046983	Function	Protein dimerization activity	IEA
GO:0051781	Process	Positive regulation of cell division	IMP	20855495
GO:0060018	Process	Astrocyte fate commitment	IEA
GO:0060216	Process	Definitive hemopoiesis	IEA
GO:0060217	Process	Hemangioblast cell differentiation	IEA
GO:0060218	Process	Hematopoietic stem cell differentiation	IEA
GO:0060375	Process	Regulation of mast cell differentiation	IEA
GO:0061098	Process	Positive regulation of protein tyrosine kinase activity	IEA
GO:0070888	Function	E-box binding	IDA	20855495
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:2000036	Process	Regulation of stem cell population maintenance	IEA
GO:2000273	Process	Positive regulation of signaling receptor activity	IEA

MIM	HGNC	e!Ensembl
187040	11556	ENSG00000162367

Protein

UniProt ID

P17542

Protein name

T-cell acute lymphocytic leukemia protein 1 (TAL-1) (Class A basic helix-loop-helix protein 17) (bHLHa17) (Stem cell protein) (T-cell leukemia/lymphoma protein 5)

Protein function

Implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. Serves as a positive regulator of erythroid differentiation (By similarity).

PDB

2YPA , 2YPB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	188 → 240	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Leukemic stem cell.

Sequence

MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGP
GGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQ
LSPPALAAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITD
GPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA
KLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAAS
PDSYTEEPAPKHTARSLHPAMLPAADGAGPR

Sequence length

331

Interactions

View interactions

	Reactome
			RUNX1 regulates transcription of genes involved in differentiation of HSCs

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Lymphoblastic leukemia	Childhood Acute Lymphoblastic Leukemia, L2 Acute Lymphoblastic Leukemia, Precursor T-Cell Lymphoblastic Leukemia-Lymphoma, Precursor Cell Lymphoblastic Leukemia Lymphoma, Precursor T-cell acute lymphoblastic leukemia	rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699 View all (13 more)	24394663, 19246562

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Source
Unknown
Neuroticism	Neuroticism	GWAS
Mental Depression	Mental Depression	GWAS
Metabolic Syndrome	Metabolic Syndrome	GWAS
Diabetes	Diabetes	GWAS
Astrocytoma	Astrocytoma	GWAS
Insomnia	Insomnia	GWAS

Show/Hide Text Mining Associations (36)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	28178989
Adenoma Islet Cell	Associate	30575306
Ataxia Telangiectasia	Associate	12086890, 16621969, 2040693, 22581002, 25615415, 36632736, 7678994, 9695959
Carcinogenesis	Associate	21179004, 9819382
Carcinoma Hepatocellular	Associate	31419443
COVID 19	Associate	36709793
Dehydrated Hereditary Stomatocytosis Pseudohyperkalemia and Perinatal Edema	Associate	17389645
Diabetes Mellitus Type 2	Associate	35046895
Diarrhea	Associate	34217275
Drug Hypersensitivity	Associate	22982397
Genetic Diseases Inborn	Associate	8471769
Leukemia	Associate	11964296, 12086890, 16621969, 17557895, 19406989, 2040693, 20656931, 26944678, 32086528, 34075404, 7605997, 7957052, 8159721, 8471769, 9111367, 9507011 View all (1 more)
Leukemia Erythroblastic Acute	Associate	19497860
Leukemia Lymphoma Adult T Cell	Associate	18495761
Leukemia Myeloid Acute	Associate	12417757, 19442316, 34075404
Leukemia Promyelocytic Acute	Associate	9111367
Leukemia T Cell	Associate	1402666, 19497860, 2209547, 2230650, 25615415, 2740341, 40378042, 8547631
Leukemia T Cell	Stimulate	17539775
Lung Neoplasms	Associate	36902378
Lymphoma	Associate	7833471
Lymphoma T Cell	Associate	1387813, 22310283
Melanoma	Associate	2740341
Mouth Diseases	Associate	2209547
Neoplasms	Associate	10233841, 23091610, 30914738, 34489925, 7957052, 8159721, 8289805, 9927512
Neuhauser syndrome	Associate	36857629
Oncogene Addiction	Associate	9927512
Osteoarthritis	Associate	33791375
Osteolysis	Associate	33791375
Pancreatic Neoplasms	Associate	21455317, 33324055
Polycythemia	Associate	22982397
Polycythemia Vera	Inhibit	23720412
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	11964296, 12130513, 15054041, 17901244, 18495761, 22563559, 30938820, 32632335, 33664368, 35963521, 7678994, 9020185
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	10233841, 12199779, 1402666, 14604958, 15054041, 16621969, 18439091, 19055661, 19406989, 20065082, 20124220, 2038315, 2040693, 21878675, 22058201 View all (38 more)
Shwachman Diamond Syndrome	Stimulate	17539775
Urinary Bladder Neoplasms	Associate	22529986
Vomiting	Associate	34217275

TAL1 (TAL bHLH transcription factor 1, erythroid differentiation factor)