Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6885
Gene name Gene Name - the full gene name approved by the HGNC.	Mitogen-activated protein kinase kinase kinase 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAP3K7
Synonyms (NCBI Gene) Gene synonyms aliases	CSCF, FMD2, MEKK7, TAK1, TGF1a
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q15
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcripti

Show/Hide all(13)

SNP ID	Visualize variation	Clinical significance	Consequence
rs886039230	G>A,C,T	Pathogenic	Coding sequence variant, intron variant, missense variant
rs886039231	C>G	Pathogenic	5 prime UTR variant, coding sequence variant, missense variant
rs886039232	A>T	Pathogenic	5 prime UTR variant, coding sequence variant, missense variant
rs886039233	C>G	Pathogenic	Coding sequence variant, missense variant
rs886039234	TCTTCC>-	Pathogenic	5 prime UTR variant, inframe deletion, coding sequence variant
rs886039235	C>A	Pathogenic	5 prime UTR variant, coding sequence variant, missense variant
rs886039236	AAC>-	Pathogenic	5 prime UTR variant, inframe deletion, coding sequence variant
rs886039237	A>C,T	Pathogenic	Coding sequence variant, missense variant
rs1057517758	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1064795771	C>T	Likely-pathogenic	Coding sequence variant, 5 prime UTR variant, missense variant
rs1180249151	C>A,T	Likely-pathogenic	Splice acceptor variant
rs1554184177	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1582233787	AAC>-	Likely-pathogenic	Coding sequence variant, 5 prime UTR variant, inframe deletion

Show/Hide all(375)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005509	hsa-miR-10a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20624982
MIRT025316	hsa-miR-34a-5p	Sequencing	20371350
MIRT005509	hsa-miR-10a-5p	Reporter assay;Other	20624982
MIRT027011	hsa-miR-103a-3p	Sequencing	20371350
MIRT051235	hsa-miR-16-5p	CLASH	23622248
MIRT036539	hsa-miR-1226-5p	CLASH	23622248
MIRT053639	hsa-miR-143-3p	Microarray	22942087
MIRT616961	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT616960	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616959	hsa-miR-3671	HITS-CLIP	23824327
MIRT616958	hsa-miR-5696	HITS-CLIP	23824327
MIRT616957	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT616956	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT616955	hsa-miR-607	HITS-CLIP	23824327
MIRT616954	hsa-miR-1305	HITS-CLIP	23824327
MIRT616953	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT566834	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT566833	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT051235	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT566832	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT566831	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT566830	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT566829	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT566828	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT566827	hsa-miR-646	PAR-CLIP	20371350
MIRT566826	hsa-miR-875-5p	PAR-CLIP	20371350
MIRT566825	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT566824	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT566823	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT566822	hsa-miR-599	PAR-CLIP	20371350
MIRT512946	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT512945	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT512944	hsa-miR-6808-5p	PAR-CLIP	20371350
MIRT512943	hsa-miR-6893-5p	PAR-CLIP	20371350
MIRT512942	hsa-miR-940	PAR-CLIP	20371350
MIRT512941	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT512940	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT512939	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT512938	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT512937	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT027011	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT512936	hsa-miR-107	PAR-CLIP	20371350
MIRT512935	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT512946	hsa-miR-1910-3p	PAR-CLIP	23446348
MIRT512945	hsa-miR-6511a-5p	PAR-CLIP	23446348
MIRT512944	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT512943	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT512942	hsa-miR-940	PAR-CLIP	23446348
MIRT512941	hsa-miR-2682-5p	PAR-CLIP	23446348
MIRT512940	hsa-miR-34b-5p	PAR-CLIP	23446348
MIRT512939	hsa-miR-449c-5p	PAR-CLIP	23446348
MIRT512938	hsa-miR-1295b-3p	PAR-CLIP	23446348
MIRT512937	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT027011	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT512936	hsa-miR-107	PAR-CLIP	23446348
MIRT512935	hsa-miR-548au-3p	PAR-CLIP	23446348
MIRT449701	hsa-miR-3914	PAR-CLIP	22100165
MIRT445925	hsa-miR-4635	PAR-CLIP	22100165
MIRT445926	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT445925	hsa-miR-4635	PAR-CLIP	22100165
MIRT445926	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT735700	hsa-miR-129-5p	Luciferase reporter assay, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR	32048803
MIRT736428	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT616961	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT616960	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT616959	hsa-miR-3671	HITS-CLIP	23824327
MIRT616958	hsa-miR-5696	HITS-CLIP	23824327
MIRT616957	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT616956	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT616955	hsa-miR-607	HITS-CLIP	23824327
MIRT616954	hsa-miR-1305	HITS-CLIP	23824327
MIRT616953	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT566834	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT566833	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT051235	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT566832	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT566831	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT566830	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT566829	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT566828	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT566827	hsa-miR-646	PAR-CLIP	20371350
MIRT566826	hsa-miR-875-5p	PAR-CLIP	20371350
MIRT566825	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT566824	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT566823	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT566822	hsa-miR-599	PAR-CLIP	20371350
MIRT512946	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT512945	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT512944	hsa-miR-6808-5p	PAR-CLIP	20371350
MIRT512943	hsa-miR-6893-5p	PAR-CLIP	20371350
MIRT512942	hsa-miR-940	PAR-CLIP	20371350
MIRT512941	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT512940	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT512939	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT512938	hsa-miR-1295b-3p	PAR-CLIP	20371350
MIRT512937	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT027011	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT512936	hsa-miR-107	PAR-CLIP	20371350
MIRT512935	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT512946	hsa-miR-1910-3p	PAR-CLIP	23446348
MIRT512945	hsa-miR-6511a-5p	PAR-CLIP	23446348
MIRT512944	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT512943	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT512942	hsa-miR-940	PAR-CLIP	23446348
MIRT512941	hsa-miR-2682-5p	PAR-CLIP	23446348
MIRT512940	hsa-miR-34b-5p	PAR-CLIP	23446348
MIRT512939	hsa-miR-449c-5p	PAR-CLIP	23446348
MIRT512938	hsa-miR-1295b-3p	PAR-CLIP	23446348
MIRT512937	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT027011	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT512936	hsa-miR-107	PAR-CLIP	23446348
MIRT512935	hsa-miR-548au-3p	PAR-CLIP	23446348
MIRT449701	hsa-miR-3914	PAR-CLIP	22100165
MIRT445925	hsa-miR-4635	PAR-CLIP	22100165
MIRT445926	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT445925	hsa-miR-4635	PAR-CLIP	22100165
MIRT445926	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT1129023	hsa-miR-103a	CLIP-seq
MIRT1129024	hsa-miR-106a	CLIP-seq
MIRT1129025	hsa-miR-106b	CLIP-seq
MIRT1129026	hsa-miR-1256	CLIP-seq
MIRT1129027	hsa-miR-1297	CLIP-seq
MIRT1129028	hsa-miR-17	CLIP-seq
MIRT1129029	hsa-miR-20a	CLIP-seq
MIRT1129030	hsa-miR-20b	CLIP-seq
MIRT1129031	hsa-miR-224	CLIP-seq
MIRT1129032	hsa-miR-2682	CLIP-seq
MIRT1129033	hsa-miR-26a	CLIP-seq
MIRT1129034	hsa-miR-26b	CLIP-seq
MIRT1129035	hsa-miR-302a	CLIP-seq
MIRT1129036	hsa-miR-302b	CLIP-seq
MIRT1129037	hsa-miR-302c	CLIP-seq
MIRT1129038	hsa-miR-302d	CLIP-seq
MIRT1129039	hsa-miR-302e	CLIP-seq
MIRT1129040	hsa-miR-372	CLIP-seq
MIRT1129041	hsa-miR-373	CLIP-seq
MIRT1129042	hsa-miR-4465	CLIP-seq
MIRT1129043	hsa-miR-449c	CLIP-seq
MIRT1129044	hsa-miR-4642	CLIP-seq
MIRT1129045	hsa-miR-4684-3p	CLIP-seq
MIRT1129046	hsa-miR-4715-5p	CLIP-seq
MIRT1129047	hsa-miR-4716-5p	CLIP-seq
MIRT1129048	hsa-miR-494	CLIP-seq
MIRT1129049	hsa-miR-512-3p	CLIP-seq
MIRT1129050	hsa-miR-518a-5p	CLIP-seq
MIRT1129051	hsa-miR-519d	CLIP-seq
MIRT1129052	hsa-miR-520a-3p	CLIP-seq
MIRT1129053	hsa-miR-520b	CLIP-seq
MIRT1129054	hsa-miR-520c-3p	CLIP-seq
MIRT1129055	hsa-miR-520d-3p	CLIP-seq
MIRT1129056	hsa-miR-520e	CLIP-seq
MIRT1129057	hsa-miR-520g	CLIP-seq
MIRT1129058	hsa-miR-520h	CLIP-seq
MIRT1129059	hsa-miR-527	CLIP-seq
MIRT1129060	hsa-miR-545	CLIP-seq
MIRT1129061	hsa-miR-582-5p	CLIP-seq
MIRT1129062	hsa-miR-767-3p	CLIP-seq
MIRT1129063	hsa-miR-93	CLIP-seq
MIRT1129023	hsa-miR-103a	CLIP-seq
MIRT1129064	hsa-miR-1205	CLIP-seq
MIRT1129065	hsa-miR-1286	CLIP-seq
MIRT1129032	hsa-miR-2682	CLIP-seq
MIRT1129066	hsa-miR-34b	CLIP-seq
MIRT1129067	hsa-miR-4418	CLIP-seq
MIRT1129043	hsa-miR-449c	CLIP-seq
MIRT1129068	hsa-miR-4722-5p	CLIP-seq
MIRT1129069	hsa-miR-509-3-5p	CLIP-seq
MIRT1129070	hsa-miR-509-5p	CLIP-seq
MIRT1129060	hsa-miR-545	CLIP-seq
MIRT1129071	hsa-miR-1258	CLIP-seq
MIRT1129072	hsa-miR-1264	CLIP-seq
MIRT1129073	hsa-miR-15a	CLIP-seq
MIRT1129074	hsa-miR-15b	CLIP-seq
MIRT1129075	hsa-miR-16	CLIP-seq
MIRT1129076	hsa-miR-188-5p	CLIP-seq
MIRT1129077	hsa-miR-195	CLIP-seq
MIRT1129078	hsa-miR-3124-3p	CLIP-seq
MIRT1129079	hsa-miR-3614-3p	CLIP-seq
MIRT1129080	hsa-miR-377	CLIP-seq
MIRT1129081	hsa-miR-424	CLIP-seq
MIRT1129082	hsa-miR-4509	CLIP-seq
MIRT1129083	hsa-miR-4524	CLIP-seq
MIRT1129084	hsa-miR-4528	CLIP-seq
MIRT1129085	hsa-miR-4652-3p	CLIP-seq
MIRT1129086	hsa-miR-497	CLIP-seq
MIRT1129087	hsa-miR-503	CLIP-seq
MIRT1129088	hsa-miR-507	CLIP-seq
MIRT1129089	hsa-miR-548m	CLIP-seq
MIRT1129090	hsa-miR-557	CLIP-seq
MIRT1129091	hsa-miR-602	CLIP-seq
MIRT1551122	hsa-miR-590-3p	CLIP-seq
MIRT2036731	hsa-miR-448	CLIP-seq
MIRT1129023	hsa-miR-103a	CLIP-seq
MIRT1129026	hsa-miR-1256	CLIP-seq
MIRT1129071	hsa-miR-1258	CLIP-seq
MIRT2266921	hsa-miR-142-5p	CLIP-seq
MIRT1129032	hsa-miR-2682	CLIP-seq
MIRT2266922	hsa-miR-297	CLIP-seq
MIRT2266923	hsa-miR-3149	CLIP-seq
MIRT2266924	hsa-miR-329	CLIP-seq
MIRT1129066	hsa-miR-34b	CLIP-seq
MIRT1129079	hsa-miR-3614-3p	CLIP-seq
MIRT2266925	hsa-miR-362-3p	CLIP-seq
MIRT1129080	hsa-miR-377	CLIP-seq
MIRT2266926	hsa-miR-3941	CLIP-seq
MIRT2266927	hsa-miR-421	CLIP-seq
MIRT2266928	hsa-miR-4282	CLIP-seq
MIRT2266929	hsa-miR-4474-5p	CLIP-seq
MIRT1129043	hsa-miR-449c	CLIP-seq
MIRT2266930	hsa-miR-4517	CLIP-seq
MIRT1129044	hsa-miR-4642	CLIP-seq
MIRT1129085	hsa-miR-4652-3p	CLIP-seq
MIRT2266931	hsa-miR-4694-3p	CLIP-seq
MIRT2266932	hsa-miR-4705	CLIP-seq
MIRT1129046	hsa-miR-4715-5p	CLIP-seq
MIRT1129047	hsa-miR-4716-5p	CLIP-seq
MIRT2266933	hsa-miR-4789-3p	CLIP-seq
MIRT1129048	hsa-miR-494	CLIP-seq
MIRT2266934	hsa-miR-495	CLIP-seq
MIRT2266935	hsa-miR-526b	CLIP-seq
MIRT1129060	hsa-miR-545	CLIP-seq
MIRT1129061	hsa-miR-582-5p	CLIP-seq
MIRT1551122	hsa-miR-590-3p	CLIP-seq
MIRT1129091	hsa-miR-602	CLIP-seq
MIRT2266936	hsa-miR-603	CLIP-seq
MIRT1129064	hsa-miR-1205	CLIP-seq
MIRT1129066	hsa-miR-34b	CLIP-seq
MIRT1129067	hsa-miR-4418	CLIP-seq
MIRT1129069	hsa-miR-509-3-5p	CLIP-seq
MIRT1129070	hsa-miR-509-5p	CLIP-seq
MIRT2453690	hsa-miR-570	CLIP-seq
MIRT1129024	hsa-miR-106a	CLIP-seq
MIRT1129025	hsa-miR-106b	CLIP-seq
MIRT2566477	hsa-miR-10a	CLIP-seq
MIRT2566478	hsa-miR-10b	CLIP-seq
MIRT1129072	hsa-miR-1264	CLIP-seq
MIRT2566479	hsa-miR-1273f	CLIP-seq
MIRT2566480	hsa-miR-1278	CLIP-seq
MIRT2566481	hsa-miR-129-3p	CLIP-seq
MIRT1129027	hsa-miR-1297	CLIP-seq
MIRT2266921	hsa-miR-142-5p	CLIP-seq
MIRT2566482	hsa-miR-143	CLIP-seq
MIRT2566483	hsa-miR-153	CLIP-seq
MIRT1129028	hsa-miR-17	CLIP-seq
MIRT1129029	hsa-miR-20a	CLIP-seq
MIRT1129030	hsa-miR-20b	CLIP-seq
MIRT1129031	hsa-miR-224	CLIP-seq
MIRT1129033	hsa-miR-26a	CLIP-seq
MIRT1129034	hsa-miR-26b	CLIP-seq
MIRT2566484	hsa-miR-300	CLIP-seq
MIRT1129035	hsa-miR-302a	CLIP-seq
MIRT1129036	hsa-miR-302b	CLIP-seq
MIRT1129037	hsa-miR-302c	CLIP-seq
MIRT1129038	hsa-miR-302d	CLIP-seq
MIRT1129039	hsa-miR-302e	CLIP-seq
MIRT2566485	hsa-miR-3122	CLIP-seq
MIRT1129078	hsa-miR-3124-3p	CLIP-seq
MIRT2566486	hsa-miR-3148	CLIP-seq
MIRT2566487	hsa-miR-3153	CLIP-seq
MIRT2566488	hsa-miR-330-3p	CLIP-seq
MIRT2566489	hsa-miR-339-5p	CLIP-seq
MIRT1129066	hsa-miR-34b	CLIP-seq
MIRT2566490	hsa-miR-369-3p	CLIP-seq
MIRT1129040	hsa-miR-372	CLIP-seq
MIRT1129041	hsa-miR-373	CLIP-seq
MIRT2566491	hsa-miR-374a	CLIP-seq
MIRT2566492	hsa-miR-374b	CLIP-seq
MIRT2566493	hsa-miR-381	CLIP-seq
MIRT2566494	hsa-miR-3913-5p	CLIP-seq
MIRT2566495	hsa-miR-4421	CLIP-seq
MIRT1129042	hsa-miR-4465	CLIP-seq
MIRT2566496	hsa-miR-4477a	CLIP-seq
MIRT2036731	hsa-miR-448	CLIP-seq
MIRT2566497	hsa-miR-4639-3p	CLIP-seq
MIRT1129044	hsa-miR-4642	CLIP-seq
MIRT2566498	hsa-miR-4668-5p	CLIP-seq
MIRT2566499	hsa-miR-4682	CLIP-seq
MIRT1129045	hsa-miR-4684-3p	CLIP-seq
MIRT2566500	hsa-miR-4698	CLIP-seq
MIRT2266932	hsa-miR-4705	CLIP-seq
MIRT2566501	hsa-miR-4708-5p	CLIP-seq
MIRT2566502	hsa-miR-4720-5p	CLIP-seq
MIRT2566503	hsa-miR-4770	CLIP-seq
MIRT2566504	hsa-miR-4799-3p	CLIP-seq
MIRT2566505	hsa-miR-4799-5p	CLIP-seq
MIRT2566506	hsa-miR-511	CLIP-seq
MIRT1129049	hsa-miR-512-3p	CLIP-seq
MIRT2566507	hsa-miR-513a-3p	CLIP-seq
MIRT1129050	hsa-miR-518a-5p	CLIP-seq
MIRT1129051	hsa-miR-519d	CLIP-seq
MIRT1129052	hsa-miR-520a-3p	CLIP-seq
MIRT1129053	hsa-miR-520b	CLIP-seq
MIRT1129054	hsa-miR-520c-3p	CLIP-seq
MIRT1129055	hsa-miR-520d-3p	CLIP-seq
MIRT1129056	hsa-miR-520e	CLIP-seq
MIRT1129057	hsa-miR-520g	CLIP-seq
MIRT1129058	hsa-miR-520h	CLIP-seq
MIRT1129059	hsa-miR-527	CLIP-seq
MIRT2566508	hsa-miR-640	CLIP-seq
MIRT1129062	hsa-miR-767-3p	CLIP-seq
MIRT2566509	hsa-miR-889	CLIP-seq
MIRT1129063	hsa-miR-93	CLIP-seq
MIRT2566510	hsa-miR-938	CLIP-seq
MIRT2566511	hsa-miR-944	CLIP-seq
MIRT1129024	hsa-miR-106a	CLIP-seq
MIRT1129025	hsa-miR-106b	CLIP-seq
MIRT2566477	hsa-miR-10a	CLIP-seq
MIRT2566478	hsa-miR-10b	CLIP-seq
MIRT1129072	hsa-miR-1264	CLIP-seq
MIRT2566479	hsa-miR-1273f	CLIP-seq
MIRT2566480	hsa-miR-1278	CLIP-seq
MIRT2566481	hsa-miR-129-3p	CLIP-seq
MIRT1129027	hsa-miR-1297	CLIP-seq
MIRT2566482	hsa-miR-143	CLIP-seq
MIRT2566483	hsa-miR-153	CLIP-seq
MIRT1129028	hsa-miR-17	CLIP-seq
MIRT1129029	hsa-miR-20a	CLIP-seq
MIRT1129030	hsa-miR-20b	CLIP-seq
MIRT1129031	hsa-miR-224	CLIP-seq
MIRT1129033	hsa-miR-26a	CLIP-seq
MIRT1129034	hsa-miR-26b	CLIP-seq
MIRT1129035	hsa-miR-302a	CLIP-seq
MIRT1129036	hsa-miR-302b	CLIP-seq
MIRT1129037	hsa-miR-302c	CLIP-seq
MIRT1129038	hsa-miR-302d	CLIP-seq
MIRT1129039	hsa-miR-302e	CLIP-seq
MIRT2566485	hsa-miR-3122	CLIP-seq
MIRT1129078	hsa-miR-3124-3p	CLIP-seq
MIRT2566486	hsa-miR-3148	CLIP-seq
MIRT2566487	hsa-miR-3153	CLIP-seq
MIRT2566488	hsa-miR-330-3p	CLIP-seq
MIRT2566489	hsa-miR-339-5p	CLIP-seq
MIRT1129066	hsa-miR-34b	CLIP-seq
MIRT2566490	hsa-miR-369-3p	CLIP-seq
MIRT1129040	hsa-miR-372	CLIP-seq
MIRT1129041	hsa-miR-373	CLIP-seq
MIRT2566491	hsa-miR-374a	CLIP-seq
MIRT2566492	hsa-miR-374b	CLIP-seq
MIRT2566494	hsa-miR-3913-5p	CLIP-seq
MIRT2566495	hsa-miR-4421	CLIP-seq
MIRT1129042	hsa-miR-4465	CLIP-seq
MIRT2566496	hsa-miR-4477a	CLIP-seq
MIRT2036731	hsa-miR-448	CLIP-seq
MIRT2566497	hsa-miR-4639-3p	CLIP-seq
MIRT1129044	hsa-miR-4642	CLIP-seq
MIRT2566498	hsa-miR-4668-5p	CLIP-seq
MIRT2566499	hsa-miR-4682	CLIP-seq
MIRT1129045	hsa-miR-4684-3p	CLIP-seq
MIRT2566500	hsa-miR-4698	CLIP-seq
MIRT2266932	hsa-miR-4705	CLIP-seq
MIRT2566501	hsa-miR-4708-5p	CLIP-seq
MIRT2566502	hsa-miR-4720-5p	CLIP-seq
MIRT2566503	hsa-miR-4770	CLIP-seq
MIRT2566504	hsa-miR-4799-3p	CLIP-seq
MIRT2566505	hsa-miR-4799-5p	CLIP-seq
MIRT2566506	hsa-miR-511	CLIP-seq
MIRT1129049	hsa-miR-512-3p	CLIP-seq
MIRT2566507	hsa-miR-513a-3p	CLIP-seq
MIRT1129050	hsa-miR-518a-5p	CLIP-seq
MIRT1129051	hsa-miR-519d	CLIP-seq
MIRT1129052	hsa-miR-520a-3p	CLIP-seq
MIRT1129053	hsa-miR-520b	CLIP-seq
MIRT1129054	hsa-miR-520c-3p	CLIP-seq
MIRT1129055	hsa-miR-520d-3p	CLIP-seq
MIRT1129056	hsa-miR-520e	CLIP-seq
MIRT1129057	hsa-miR-520g	CLIP-seq
MIRT1129058	hsa-miR-520h	CLIP-seq
MIRT1129059	hsa-miR-527	CLIP-seq
MIRT1129091	hsa-miR-602	CLIP-seq
MIRT2566508	hsa-miR-640	CLIP-seq
MIRT1129062	hsa-miR-767-3p	CLIP-seq
MIRT2566509	hsa-miR-889	CLIP-seq
MIRT1129063	hsa-miR-93	CLIP-seq
MIRT2566510	hsa-miR-938	CLIP-seq
MIRT2566511	hsa-miR-944	CLIP-seq

Show/Hide all(117)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IDA	8663074, 11865055
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IEA
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002726	Process	Positive regulation of T cell cytokine production	IMP	15125833
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	TAS
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	10702308, 11460167, 20538596
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10094049, 10702308, 11460167, 37832545
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IDA	11865055
GO:0004709	Function	MAP kinase kinase kinase activity	EXP	11460167
GO:0004709	Function	MAP kinase kinase kinase activity	IBA
GO:0004709	Function	MAP kinase kinase kinase activity	IDA	8663074, 9079627, 11460167
GO:0004709	Function	MAP kinase kinase kinase activity	IEA
GO:0004709	Function	MAP kinase kinase kinase activity	TAS	9466656
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	10094049, 11460167, 11865055, 12496252, 14743216, 15075345, 15764709, 16840345, 16845370, 17079228, 17110930, 17158449, 17363973, 17449468, 17709393, 18286207, 18591963, 18758450, 19026643, 19820695, 21512573, 21903422, 22081109, 22158122, 22904686, 25241761, 26334375, 27426733, 278
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IC	19675569, 34871740
GO:0005737	Component	Cytoplasm	IDA	12242293
GO:0005737	Component	Cytoplasm	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	37832545
GO:0005829	Component	Cytosol	IDA	12242293
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IDA	10748004
GO:0006954	Process	Inflammatory response	IDA	34017102
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS	9466656
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	1406630, 9244310, 9252186, 9346484, 25038658, 34721373
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	10882101, 19675569, 34871740, 35952808
GO:0007249	Process	Canonical NF-kappaB signal transduction	TAS
GO:0007252	Process	I-kappaB phosphorylation	IDA	11460167
GO:0007254	Process	JNK cascade	IBA
GO:0007254	Process	JNK cascade	IDA	9079627
GO:0007254	Process	JNK cascade	TAS
GO:0008349	Function	MAP kinase kinase kinase kinase activity	TAS
GO:0009893	Process	Positive regulation of metabolic process	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0016020	Component	Membrane	IEA
GO:0016239	Process	Positive regulation of macroautophagy	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IDA	1406630, 9346484, 25038658, 34721373
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	18762249
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	24936062
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032481	Process	Positive regulation of type I interferon production	IDA	25636800
GO:0032527	Process	Protein exit from endoplasmic reticulum	IDA	32690950, 37832545
GO:0032743	Process	Positive regulation of interleukin-2 production	IMP	15125833
GO:0034138	Process	Toll-like receptor 3 signaling pathway	TAS
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	7479976, 25355951, 26189595
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	25371197
GO:0035173	Function	Histone kinase activity	IEA
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0035872	Process	Nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway	TAS
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IDA	12048232, 26189595
GO:0038066	Process	P38MAPK cascade	IDA	10330143, 11460167
GO:0038066	Process	P38MAPK cascade	IDA	11460167
GO:0038066	Process	P38MAPK cascade	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IDA	20532808
GO:0038173	Process	Interleukin-17A-mediated signaling pathway	IDA	31376257
GO:0042742	Process	Defense response to bacterium	IDA	11460167
GO:0042770	Process	Signal transduction in response to DNA damage	IDA	24936062
GO:0042770	Process	Signal transduction in response to DNA damage	TAS	24936062
GO:0042802	Function	Identical protein binding	IPI	27426733
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	9346484
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	11460167
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	14982987
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	25038658
GO:0043276	Process	Anoikis	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043507	Process	Positive regulation of JUN kinase activity	IDA	11460167
GO:0045787	Process	Positive regulation of cell cycle	IEA
GO:0045793	Process	Positive regulation of cell size	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050852	Process	T cell receptor signaling pathway	NAS	15125833
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0051403	Process	Stress-activated MAPK cascade	IDA	9079627
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IMP	10094049
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0097110	Function	Scaffold protein binding	IDA	23776175
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0120283	Function	Protein serine/threonine kinase binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140672	Component	ATAC complex	IDA	18838386
GO:0140896	Process	CGAS/STING signaling pathway	IDA	25636800
GO:0141111	Process	Positive regulation of cGAS/STING signaling pathway	IDA	37832545
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IDA	16968406
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IMP	10094049
GO:1904385	Process	Cellular response to angiotensin	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1904754	Process	Positive regulation of vascular associated smooth muscle cell migration	IEA
GO:1990450	Function	Linear polyubiquitin binding	IDA	35952808
GO:1990776	Process	Response to angiotensin	IEA

MIM	HGNC	e!Ensembl
602614	6859	ENSG00000135341

Protein

UniProt ID

O43318

Protein name

Mitogen-activated protein kinase kinase kinase 7 (EC 2.7.11.25) (Transforming growth factor-beta-activated kinase 1) (TGF-beta-activated kinase 1)

Protein function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway (PubMed:10094049, PubMed:11460167, PubMed:12589052, PubMed:16845370, PubMed:16893890, PubMed:21512573, PubMed:8663074, PubMed:9079627). Pl

PDB

2EVA , 2YIY , 4GS6 , 4L3P , 4L52 , 4L53 , 4O91 , 5E7R , 5GJD , 5GJF , 5GJG , 5J7S , 5J8I , 5J9L , 5JGA , 5JGB , 5JGD , 5JH6 , 5JK3 , 5V5N , 7NTH , 7NTI , 8GW3 , 9FPD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07714	PK_Tyr_Ser-Thr	36 → 284	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1A is the most abundant in ovary, skeletal muscle, spleen and blood mononuclear cells. Isoform 1B is highly expressed in brain, kidney and small intestine. Isoform 1C is the major form in prostate. Isoform 1D is the less abunda

Sequence

MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS

Sequence length

606

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway NF-kappa B signaling pathway Autophagy - animal AMPK signaling pathway Wnt signaling pathway Osteoclast differentiation Adherens junction Neutrophil extracellular trap formation Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway IL-17 signaling pathway T cell receptor signaling pathway TNF signaling pathway Alcoholic liver disease Pathogenic Escherichia coli infection Shigellosis Salmonella infection Yersinia infection Leishmaniasis Toxoplasmosis Hepatitis B Measles Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Lipid and atherosclerosis Fluid shear stress and atherosclerosis		NOD1/2 Signaling Pathway Downstream TCR signaling FCERI mediated NF-kB activation Ca2+ pathway TAK1 activates NFkB by phosphorylation and activation of IKKs complex activated TAK1 mediates p38 MAPK activation JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 TNFR1-induced NFkappaB signaling pathway CLEC7A (Dectin-1) signaling Ub-specific processing proteases TICAM1,TRAF6-dependent induction of TAK1 complex Interleukin-1 signaling IRAK2 mediated activation of TAK1 complex TRAF6-mediated induction of TAK1 complex within TLR4 complex Alpha-protein kinase 1 signaling pathway IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Cardiospondylocarpofacial Syndrome	cardiospondylocarpofacial syndrome	rs886039234, rs886039235, rs886039236, rs886039237, rs1582233787	N/A
Frontometaphyseal Dysplasia	frontometaphyseal dysplasia 2	rs1180249151, rs886039230, rs886039231, rs886039232, rs886039233	N/A

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Astrocytoma	Pilocytic astrocytoma	N/A	N/A	GWAS
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Colorectal Cancer	Metastasis in stage I-III microsatellite instability low/stable colorectal cancer (time to event)	N/A	N/A	GWAS
Fibromuscular Dysplasia	Fibromuscular dysplasia	N/A	N/A	GWAS
Oligodendroglioma	Oligodendroglioma	N/A	N/A	GWAS
Sclerosing Cholangitis	Primary sclerosing cholangitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (89)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	26291056, 30656528
Aggressive Periodontitis	Associate	28883894
Ameloblastoma	Associate	34508164
Anemia	Associate	34930825
Antiphospholipid Syndrome	Associate	37914735
Arthritis Rheumatoid	Associate	26776603, 27847407
Atrial Fibrillation	Stimulate	28323847
Bacterial Infections	Associate	27771295
Breast Neoplasms	Associate	16000313, 19049961, 21834757, 27599572, 28746466
Carcinogenesis	Associate	34075691
Carcinoma Hepatocellular	Associate	21721029, 23472066, 24565101, 34841685
Carcinoma Non Small Cell Lung	Associate	26884850
Carcinoma Ovarian Epithelial	Associate	31485280
Carcinoma Renal Cell	Associate	23534745
Carcinoma Squamous Cell	Inhibit	28102840
Cardiomyopathies	Associate	35730652
Colonic Neoplasms	Associate	39333335
Colorectal Neoplasms	Associate	21834757, 27655129, 29328486, 31592535, 36270986
Connective Tissue Diseases	Associate	29467388, 35730652
Contracture	Associate	32299812
Coronary Artery Disease	Associate	39445733
Corticosteroid Binding Globulin Deficiency	Associate	24024497
Crohn Disease	Associate	26185333
Developmental Disabilities	Associate	27426734
Drug Related Side Effects and Adverse Reactions	Inhibit	27655129
Facial Dysmorphism with Multiple Malformations	Associate	32299812
Fever	Inhibit	35042442
Fibrosis	Associate	26185333
Filaminopathy autosomal dominant	Associate	27426733
Forney Robinson Pascoe syndrome	Associate	27426734, 29467388, 32105826, 32299812, 35700636, 35730652
Frontometaphyseal dysplasia	Associate	27426733, 29467388, 32299812, 35730652
Gastritis	Associate	24082073
Gastrointestinal Diseases	Associate	29467388
Glioma	Stimulate	38002938
Growth Disorders	Associate	32105826, 32299812
Head and Neck Neoplasms	Associate	22641218
Heart Defects Congenital	Associate	29904178
Heart Diseases	Associate	29467388, 35730652
Heart Septal Defects	Associate	32105826
Heart Valve Diseases	Associate	32105826
Hemoglobinuria Paroxysmal	Associate	17379072
HIV Infections	Associate	26401039
Hypercholesterolemia	Associate	39445733
Hyperplasia	Associate	34930825
Inflammation	Associate	17114497, 21233843, 21820422, 24082073, 24386391, 24942571, 26185333, 27426734, 29649324, 31485280, 31701553, 32299812, 34271980, 34922604, 37914735, 38359662 View all (1 more)
Intervertebral Disc Degeneration	Associate	38359662
Iridogoniodysgenesis and skeletal anomalies	Associate	32105826
Joint Instability	Associate	29467388
Kidney Neoplasms	Associate	29991691
Legionnaires' Disease	Associate	20051107
Leukemia	Associate	10607714, 21820422, 29914415
Leukemia Myeloid Acute	Associate	20159944
Lupus Erythematosus Systemic	Associate	36309313
Lymphatic Metastasis	Inhibit	23370768
Lymphatic Metastasis	Associate	26823762, 26884850
Lymphoma	Associate	22649101
Lymphoma Large B Cell Diffuse	Associate	19412164, 28256087
Lymphoma Mantle Cell	Associate	22649101
Melanoma	Associate	17173073, 25889255, 31549767
Multiple Myeloma	Associate	24466111, 36121114
Multiple Sclerosis	Associate	34271980
Myelodysplastic Syndromes	Associate	34930825
N syndrome	Associate	27655129
Neoplasm Metastasis	Associate	23534745, 30656528, 34841685
Neoplasms	Associate	20520770, 21834757, 23534745, 24466111, 27426734, 27599572, 27655129, 27708225, 28345459, 30656528, 30753595, 34841685, 35361778, 38002938
Neoplasms	Inhibit	23370768, 28102840
Neoplastic Syndromes Hereditary	Associate	29467388
Neurofibromatosis Noonan syndrome	Associate	26185333
Non alcoholic Fatty Liver Disease	Associate	36495944
Noonan Syndrome	Associate	35730652
Osteoarthritis	Associate	24547725, 28668088
Ovarian Neoplasms	Associate	32945454
Periodic fever familial autosomal dominant	Associate	31009059
Personality Disorders	Associate	33846123
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	29914415
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	31521893
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	29914415
Prostatic Neoplasms	Associate	23370768, 26501111, 31300540, 32763409, 33115829, 33846123
Prostatitis	Associate	30656528, 31300540
Pulmonary Disease Chronic Obstructive	Associate	26617776
Scrub Typhus	Associate	33807835
Skin Diseases	Associate	29467388
Squamous Cell Carcinoma of Head and Neck	Associate	22641218
Stomach Neoplasms	Associate	24082073, 26846663, 28560435, 28714004, 34075691
Thakker Donnai syndrome	Associate	32105826
Thyroid Neoplasms	Associate	26823762, 33966040
Triple Negative Breast Neoplasms	Associate	32054925, 33461373
Tuberculosis Spinal	Associate	28829887
Urinary Bladder Neoplasms	Associate	24466111

MAP3K7 (mitogen-activated protein kinase kinase kinase 7)