Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	688
Gene name Gene Name - the full gene name approved by the HGNC.	KLF transcription factor 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KLF5
Synonyms (NCBI Gene) Gene synonyms aliases	BTEB2, CKLF, IKLF
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the Kruppel-like factor subfamily of zinc finger proteins. The encoded protein is a transcriptional activator that binds directly to a specific recognition motif in the promoters of target genes. This protein acts downstream

Show/Hide all(201)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001812	hsa-miR-141-3p	Luciferase reporter assay	15131085
MIRT021472	hsa-miR-9-5p	Microarray	17612493
MIRT001812	hsa-miR-141-3p	Reporter assay;Other	15131085
MIRT022040	hsa-miR-128-3p	Microarray	17612493
MIRT030940	hsa-miR-21-5p	Microarray	18591254
MIRT053217	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Western blot	23128394
MIRT000306	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	23128394
MIRT000306	hsa-miR-145-5p	qRT-PCR, Western blot	25273883
MIRT000306	hsa-miR-145-5p	qRT-PCR, Western blot	25273883
MIRT445485	hsa-miR-4668-3p	PAR-CLIP	22100165
MIRT445483	hsa-miR-4480	PAR-CLIP	22100165
MIRT445484	hsa-miR-489-3p	PAR-CLIP	22100165
MIRT445485	hsa-miR-4668-3p	PAR-CLIP	22100165
MIRT445483	hsa-miR-4480	PAR-CLIP	22100165
MIRT445484	hsa-miR-489-3p	PAR-CLIP	22100165
MIRT445485	hsa-miR-4668-3p	PAR-CLIP	22100165
MIRT445483	hsa-miR-4480	PAR-CLIP	22100165
MIRT445484	hsa-miR-489-3p	PAR-CLIP	22100165
MIRT445485	hsa-miR-4668-3p	PAR-CLIP	22100165
MIRT445483	hsa-miR-4480	PAR-CLIP	22100165
MIRT445484	hsa-miR-489-3p	PAR-CLIP	22100165
MIRT755350	hsa-miR-375	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP)	36074222
MIRT755620	hsa-miR-202-5p	qRT-PCR	35795823
MIRT000306	hsa-miR-145-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC), In situ hybridization	37997376
MIRT756193	hsa-miR-223-3p	Western blotting, qRT-PCR	38155264
MIRT1096611	hsa-miR-101	CLIP-seq
MIRT1096612	hsa-miR-1179	CLIP-seq
MIRT1096613	hsa-miR-1183	CLIP-seq
MIRT1096614	hsa-miR-1202	CLIP-seq
MIRT1096615	hsa-miR-1257	CLIP-seq
MIRT1096616	hsa-miR-127-5p	CLIP-seq
MIRT1096617	hsa-miR-1278	CLIP-seq
MIRT1096618	hsa-miR-1282	CLIP-seq
MIRT1096619	hsa-miR-21	CLIP-seq
MIRT1096620	hsa-miR-217	CLIP-seq
MIRT1096621	hsa-miR-219-2-3p	CLIP-seq
MIRT1096622	hsa-miR-2964a-3p	CLIP-seq
MIRT1096623	hsa-miR-3135	CLIP-seq
MIRT1096624	hsa-miR-3149	CLIP-seq
MIRT1096625	hsa-miR-3163	CLIP-seq
MIRT1096626	hsa-miR-3180-5p	CLIP-seq
MIRT1096627	hsa-miR-3545-3p	CLIP-seq
MIRT1096628	hsa-miR-3611	CLIP-seq
MIRT1096629	hsa-miR-3650	CLIP-seq
MIRT1096630	hsa-miR-3662	CLIP-seq
MIRT1096631	hsa-miR-3675-3p	CLIP-seq
MIRT1096632	hsa-miR-3692	CLIP-seq
MIRT1096633	hsa-miR-374a	CLIP-seq
MIRT1096634	hsa-miR-374b	CLIP-seq
MIRT1096635	hsa-miR-374c	CLIP-seq
MIRT755350	hsa-miR-375	CLIP-seq
MIRT1096636	hsa-miR-3938	CLIP-seq
MIRT1096637	hsa-miR-3972	CLIP-seq
MIRT1096638	hsa-miR-4328	CLIP-seq
MIRT1096639	hsa-miR-4418	CLIP-seq
MIRT1096640	hsa-miR-4666-3p	CLIP-seq
MIRT1096641	hsa-miR-4699-3p	CLIP-seq
MIRT1096642	hsa-miR-4709-5p	CLIP-seq
MIRT1096643	hsa-miR-4729	CLIP-seq
MIRT1096644	hsa-miR-4755-3p	CLIP-seq
MIRT1096645	hsa-miR-4760-3p	CLIP-seq
MIRT1096646	hsa-miR-4786-3p	CLIP-seq
MIRT1096647	hsa-miR-500a	CLIP-seq
MIRT1096648	hsa-miR-509-3-5p	CLIP-seq
MIRT1096649	hsa-miR-509-5p	CLIP-seq
MIRT1096650	hsa-miR-520a-5p	CLIP-seq
MIRT1096651	hsa-miR-520d-5p	CLIP-seq
MIRT1096652	hsa-miR-524-5p	CLIP-seq
MIRT1096653	hsa-miR-525-5p	CLIP-seq
MIRT1096654	hsa-miR-532-5p	CLIP-seq
MIRT1096655	hsa-miR-548ac	CLIP-seq
MIRT1096656	hsa-miR-548ae	CLIP-seq
MIRT1096657	hsa-miR-548aj	CLIP-seq
MIRT1096658	hsa-miR-548am	CLIP-seq
MIRT1096659	hsa-miR-548d-3p	CLIP-seq
MIRT1096660	hsa-miR-548x	CLIP-seq
MIRT1096661	hsa-miR-548z	CLIP-seq
MIRT1096662	hsa-miR-590-5p	CLIP-seq
MIRT1096663	hsa-miR-600	CLIP-seq
MIRT1096664	hsa-miR-603	CLIP-seq
MIRT1096665	hsa-miR-630	CLIP-seq
MIRT1096666	hsa-miR-655	CLIP-seq
MIRT1096667	hsa-miR-670	CLIP-seq
MIRT1096668	hsa-miR-758	CLIP-seq
MIRT1096669	hsa-miR-9	CLIP-seq
MIRT1096670	hsa-miR-944	CLIP-seq
MIRT1096611	hsa-miR-101	CLIP-seq
MIRT1096617	hsa-miR-1278	CLIP-seq
MIRT1096618	hsa-miR-1282	CLIP-seq
MIRT1096620	hsa-miR-217	CLIP-seq
MIRT2026120	hsa-miR-23a	CLIP-seq
MIRT2026121	hsa-miR-23b	CLIP-seq
MIRT2026122	hsa-miR-23c	CLIP-seq
MIRT1096623	hsa-miR-3135	CLIP-seq
MIRT1096626	hsa-miR-3180-5p	CLIP-seq
MIRT2026123	hsa-miR-3182	CLIP-seq
MIRT2026124	hsa-miR-339-5p	CLIP-seq
MIRT2026125	hsa-miR-3646	CLIP-seq
MIRT2026126	hsa-miR-3658	CLIP-seq
MIRT1096630	hsa-miR-3662	CLIP-seq
MIRT2026127	hsa-miR-3671	CLIP-seq
MIRT2026128	hsa-miR-371-5p	CLIP-seq
MIRT2026129	hsa-miR-371b-5p	CLIP-seq
MIRT1096635	hsa-miR-374c	CLIP-seq
MIRT1096636	hsa-miR-3938	CLIP-seq
MIRT2026130	hsa-miR-4299	CLIP-seq
MIRT1096639	hsa-miR-4418	CLIP-seq
MIRT2026131	hsa-miR-4456	CLIP-seq
MIRT2026132	hsa-miR-4659a-3p	CLIP-seq
MIRT2026133	hsa-miR-4659b-3p	CLIP-seq
MIRT1096640	hsa-miR-4666-3p	CLIP-seq
MIRT1096641	hsa-miR-4699-3p	CLIP-seq
MIRT1096642	hsa-miR-4709-5p	CLIP-seq
MIRT2026134	hsa-miR-4711-5p	CLIP-seq
MIRT2026135	hsa-miR-4722-3p	CLIP-seq
MIRT2026136	hsa-miR-4763-5p	CLIP-seq
MIRT2026137	hsa-miR-4778-3p	CLIP-seq
MIRT1096648	hsa-miR-509-3-5p	CLIP-seq
MIRT1096649	hsa-miR-509-5p	CLIP-seq
MIRT2026138	hsa-miR-513c	CLIP-seq
MIRT2026139	hsa-miR-514b-5p	CLIP-seq
MIRT2026140	hsa-miR-548q	CLIP-seq
MIRT2026141	hsa-miR-550a	CLIP-seq
MIRT1096665	hsa-miR-630	CLIP-seq
MIRT1096666	hsa-miR-655	CLIP-seq
MIRT1096667	hsa-miR-670	CLIP-seq
MIRT1096611	hsa-miR-101	CLIP-seq
MIRT1096612	hsa-miR-1179	CLIP-seq
MIRT2257201	hsa-miR-1273f	CLIP-seq
MIRT1096616	hsa-miR-127-5p	CLIP-seq
MIRT1096617	hsa-miR-1278	CLIP-seq
MIRT1096618	hsa-miR-1282	CLIP-seq
MIRT2257202	hsa-miR-1305	CLIP-seq
MIRT2257203	hsa-miR-143	CLIP-seq
MIRT2257204	hsa-miR-186	CLIP-seq
MIRT2257205	hsa-miR-1913	CLIP-seq
MIRT2257206	hsa-miR-2115	CLIP-seq
MIRT1096620	hsa-miR-217	CLIP-seq
MIRT2026120	hsa-miR-23a	CLIP-seq
MIRT2026121	hsa-miR-23b	CLIP-seq
MIRT2026122	hsa-miR-23c	CLIP-seq
MIRT2257207	hsa-miR-3120-3p	CLIP-seq
MIRT2257208	hsa-miR-3133	CLIP-seq
MIRT1096623	hsa-miR-3135	CLIP-seq
MIRT2257209	hsa-miR-3140-3p	CLIP-seq
MIRT1096626	hsa-miR-3180-5p	CLIP-seq
MIRT2257210	hsa-miR-323-3p	CLIP-seq
MIRT2257211	hsa-miR-324-3p	CLIP-seq
MIRT1096630	hsa-miR-3662	CLIP-seq
MIRT2257212	hsa-miR-3667-3p	CLIP-seq
MIRT1096635	hsa-miR-374c	CLIP-seq
MIRT2257213	hsa-miR-3977	CLIP-seq
MIRT2257214	hsa-miR-421	CLIP-seq
MIRT2257215	hsa-miR-4310	CLIP-seq
MIRT1096638	hsa-miR-4328	CLIP-seq
MIRT1096639	hsa-miR-4418	CLIP-seq
MIRT2257216	hsa-miR-4509	CLIP-seq
MIRT1096640	hsa-miR-4666-3p	CLIP-seq
MIRT1096641	hsa-miR-4699-3p	CLIP-seq
MIRT2257217	hsa-miR-4708-5p	CLIP-seq
MIRT1096642	hsa-miR-4709-5p	CLIP-seq
MIRT2026134	hsa-miR-4711-5p	CLIP-seq
MIRT2257218	hsa-miR-4716-5p	CLIP-seq
MIRT2257219	hsa-miR-4727-5p	CLIP-seq
MIRT1096643	hsa-miR-4729	CLIP-seq
MIRT2257220	hsa-miR-4744	CLIP-seq
MIRT2257221	hsa-miR-4770	CLIP-seq
MIRT2257222	hsa-miR-4778-5p	CLIP-seq
MIRT1096646	hsa-miR-4786-3p	CLIP-seq
MIRT1096648	hsa-miR-509-3-5p	CLIP-seq
MIRT1096649	hsa-miR-509-5p	CLIP-seq
MIRT2257223	hsa-miR-516a-3p	CLIP-seq
MIRT1096650	hsa-miR-520a-5p	CLIP-seq
MIRT1096651	hsa-miR-520d-5p	CLIP-seq
MIRT1096652	hsa-miR-524-5p	CLIP-seq
MIRT1096653	hsa-miR-525-5p	CLIP-seq
MIRT1096655	hsa-miR-548ac	CLIP-seq
MIRT1096656	hsa-miR-548ae	CLIP-seq
MIRT1096657	hsa-miR-548aj	CLIP-seq
MIRT1096658	hsa-miR-548am	CLIP-seq
MIRT1096659	hsa-miR-548d-3p	CLIP-seq
MIRT1096660	hsa-miR-548x	CLIP-seq
MIRT1096661	hsa-miR-548z	CLIP-seq
MIRT1096663	hsa-miR-600	CLIP-seq
MIRT1096664	hsa-miR-603	CLIP-seq
MIRT2257224	hsa-miR-604	CLIP-seq
MIRT2257225	hsa-miR-616	CLIP-seq
MIRT2257226	hsa-miR-642a	CLIP-seq
MIRT2257227	hsa-miR-647	CLIP-seq
MIRT1096666	hsa-miR-655	CLIP-seq
MIRT2257228	hsa-miR-659	CLIP-seq
MIRT2257229	hsa-miR-660	CLIP-seq
MIRT1096669	hsa-miR-9	CLIP-seq
MIRT2257230	hsa-miR-938	CLIP-seq
MIRT1096670	hsa-miR-944	CLIP-seq
MIRT2430464	hsa-miR-145	CLIP-seq
MIRT2430465	hsa-miR-300	CLIP-seq
MIRT1096626	hsa-miR-3180-5p	CLIP-seq
MIRT2026127	hsa-miR-3671	CLIP-seq
MIRT2430466	hsa-miR-381	CLIP-seq
MIRT1096640	hsa-miR-4666-3p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
AR	Unknown	19460858
SMURF2	Repression	21953463

Show/Hide all(42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	16595680
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16595680
GO:0001525	Process	Angiogenesis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	17320083, 32814053, 35140242
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0014816	Process	Skeletal muscle satellite cell differentiation	IEA
GO:0014901	Process	Satellite cell activation involved in skeletal muscle regeneration	IEA
GO:0014908	Process	Myotube differentiation involved in skeletal muscle regeneration	IEA
GO:0030033	Process	Microvillus assembly	IEA
GO:0032534	Process	Regulation of microvillus assembly	IEA
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0043403	Process	Skeletal muscle tissue regeneration	IEA
GO:0043426	Function	MRF binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16595680
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060576	Process	Intestinal epithelial cell development	IEA
GO:0061586	Process	Positive regulation of transcription by transcription factor localization	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:1990859	Process	Cellular response to endothelin	IEA

MIM	HGNC	e!Ensembl
602903	6349	ENSG00000102554

Protein

UniProt ID

Q13887

Protein name

Krueppel-like factor 5 (Basic transcription element-binding protein 2) (BTE-binding protein 2) (Colon krueppel-like factor) (GC-box-binding protein 2) (Intestinal-enriched krueppel-like factor) (Transcription factor BTEB2)

Protein function

Transcription factor that binds to GC box promoter elements. Activates the transcription of these genes.

PDB

2EBT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	373 → 397	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	403 → 427	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	433 → 455	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed only in testis and placenta.

Sequence

MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQA
QPAPAQAPQPAQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVV
DQFFTDTEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPP
APTQALPEFTSIFSSHQTAAPEVNNIFIKQELPTPDLHLSVPTQQGHLYQLLNTPDLDMP
SSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQGMPPCTYTMPSQFLPQQATYF
PPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYN
RRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDEL
TRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN

Sequence length

457

Interactions

View interactions

	KEGG
	Chemical carcinogenesis - receptor activation

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Dilated Cardiomyopathy	Dilated cardiomyopathy 1FF	rs2044646731	N/A

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Eczema	Eczema	N/A	N/A	GWAS
Keratoconus	Keratoconus	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (83)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	32880368, 33115806
Adenocarcinoma of Lung	Associate	27158780, 35154481, 37181807
Anophthalmia with pulmonary hypoplasia	Associate	38433576
Aortic Aneurysm Abdominal	Associate	28912007
Atherosclerosis	Stimulate	26992033
Barrett Esophagus	Associate	32880368
Biliary Atresia	Associate	40366121
Breast Neoplasms	Associate	19411256, 19569049, 21674249, 23913682, 26079537, 26419610, 27117709, 31360115, 31467112, 35022570, 35342356, 37063424, 37997376
Breast Neoplasms	Inhibit	21542805, 31640084
Carcinogenesis	Associate	16223724, 16357509, 16595680, 18774944, 19671674, 20388706, 21542805, 23913682, 23975368, 24401325, 30770877, 31467112, 33827480
Carcinoma Hepatocellular	Associate	26176896, 31599412, 32965165
Carcinoma in Situ	Associate	21674249
Carcinoma Non Small Cell Lung	Associate	29898734, 34856848
Carcinoma Non Small Cell Lung	Stimulate	30900384
Carcinoma Pancreatic Ductal	Associate	26769127
Carcinoma Renal Cell	Associate	39215019
Carcinoma Squamous Cell	Associate	34272396, 39948701
Cardiovascular Diseases	Associate	26792671
Chromosomal Instability	Associate	33923166
Colonic Neoplasms	Associate	17164780
Colorectal Neoplasms	Associate	17430902, 19240162, 19671674, 23880760, 24398687, 25037223, 25683913, 30478887, 32279400, 34707247, 35283273
Coronary Artery Disease	Associate	37268267
COVID 19	Associate	38168026
Cysts	Associate	37494057
Diabetes Mellitus	Associate	18670098, 28711598, 30271790, 37268267
Diabetes Mellitus	Stimulate	30271790
Diabetic Nephropathies	Associate	34735495
Dissection Thoracic Aorta	Associate	27353340
Drug Related Side Effects and Adverse Reactions	Associate	31467112
Esophageal Neoplasms	Associate	16357509, 33529461
Esophageal Neoplasms	Inhibit	22990386
Esophageal Squamous Cell Carcinoma	Associate	22990386, 33789967
Esophageal Squamous Cell Carcinoma	Stimulate	38087142
Familial cylindromatosis	Associate	31409603
Hereditary Breast and Ovarian Cancer Syndrome	Associate	19411256, 19569049
Hidradenitis Suppurativa	Associate	37494057
Hypoxia	Stimulate	19671674, 29898734
Inflammation	Associate	26176896, 26474386, 28711598, 30197161, 35249460, 37063424, 39476105
Laryngeal Neoplasms	Associate	23975368, 31115014, 32271410
Lead Poisoning Nervous System	Associate	35723551
Leukemia Myeloid Acute	Associate	24584857
Leukemia Promyelocytic Acute	Associate	24584857
Liver Neoplasms	Associate	32279400
Lung Neoplasms	Associate	24401325, 35154481
Lung Neoplasms	Stimulate	37181807
Lupus Erythematosus Systemic	Associate	31178864
Lymphatic Metastasis	Associate	23975368
Lymphatic Metastasis	Stimulate	38087142
Metabolic Diseases	Associate	37268267
Mouth Neoplasms	Associate	26097551, 38147910
Nasopharyngeal Carcinoma	Associate	18570662, 35836107
Neoplasm Invasiveness	Associate	21674249
Neoplasm Metastasis	Inhibit	16357509
Neoplasm Metastasis	Associate	26419610, 32279400, 36633714
Neoplasms	Associate	16595680, 17164780, 20388706, 21169070, 21674249, 23975368, 26097551, 26419610, 26656844, 27158780, 27225414, 28030791, 32279400, 32373958, 33115806 View all (12 more)
Neoplasms	Inhibit	18570662, 19671674, 21542805, 22990386
Neoplasms	Stimulate	26176896, 26474386, 39948701
Neoplasms Squamous Cell	Inhibit	22990386, 23633919
Neoplasms Squamous Cell	Stimulate	33115806
Neoplasms Squamous Cell	Associate	35281530, 38087142
Neuroendocrine Tumors	Associate	37289025
Osteoarthritis	Associate	35723551
Osteosarcoma	Associate	36272150
Ovarian Neoplasms	Associate	23869764, 37702443
Pancreatic Neoplasms	Stimulate	19671674
Pancreatic Neoplasms	Associate	24041470, 25409614, 31327760, 31917448, 31997706, 38433576
Periodontitis	Associate	35249460
Personality Disorders	Associate	38052806
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	16595680
Prostatic Neoplasms	Associate	18774944, 19460858, 32281273, 34737261, 38052806
Prostatic Neoplasms Castration Resistant	Stimulate	34737261
Prostatitis	Associate	11326315
Pulmonary Arterial Hypertension	Associate	31257528
Pulmonary Disease Chronic Obstructive	Associate	26792671
Rectal Neoplasms	Associate	34860243
Sarcopenia	Associate	32093658
Squamous Cell Carcinoma of Head and Neck	Associate	23975368, 26474386, 35398964
Stomach Neoplasms	Associate	30685841, 30770877, 31235682, 32373958, 33923166
Triple Negative Breast Neoplasms	Associate	28030791, 28437471, 32025209, 36042208, 36509121, 36633714
Urinary Bladder Neoplasms	Associate	26786295, 27514407, 28109084
Uterine Cervical Dysplasia	Associate	31235682
Uterine Cervical Neoplasms	Stimulate	25119587
Uterine Cervical Neoplasms	Associate	30018982, 30131089, 33827480, 34233586

KLF5 (KLF transcription factor 5)