Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
687
Gene name Gene Name - the full gene name approved by the HGNC.
KLF transcription factor 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLF9
Synonyms (NCBI Gene) Gene synonyms aliases
BTEB, BTEB1
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q21.12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates trans
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006886 hsa-miR-200c-3p Luciferase reporter assay, Western blot 22569286
MIRT018674 hsa-miR-335-5p Microarray 18185580
MIRT020267 hsa-miR-130b-3p Sequencing 20371350
MIRT022972 hsa-miR-124-3p Microarray 18668037
MIRT024152 hsa-miR-221-3p Sequencing 20371350
Transcription factors
Transcription factor Regulation Reference
HOXA10 Repression 20463357
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003700 Function DNA-binding transcription factor activity TAS 1356762, 8051167
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602902 1123 ENSG00000119138
Protein
UniProt ID Q13886
Protein name Krueppel-like factor 9 (Basic transcription element-binding protein 1) (BTE-binding protein 1) (GC-box-binding protein 1) (Transcription factor BTEB1)
Protein function Transcription factor that binds to GC box promoter elements. Selectively activates mRNA synthesis from genes containing tandem repeats of GC boxes but represses genes with a single GC box. Acts as an epidermal circadian transcription factor regu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 143 167 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 173 197 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 203 225 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Epidermis (at protein level). {ECO:0000269|PubMed:22711835}.
Sequence
MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTL
VTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSA
PSPLSLLHPGVAAKGKHASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDC
LKKFSRSDELTRHYRTH
TGEKQFRCPLCEKRFMRSDHLTKHARRHTEFHPSMIKRSKKAL
ANAL
Sequence length 244
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Unknown
Disease term Disease name Evidence References Source
Endometriosis Endometriosis 21063030 ClinVar
Heart failure Heart Failure, Diastolic 29556499 ClinVar
Migraine with Aura Migraine with Aura GWAS
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
alpha 1 Antitrypsin Deficiency Stimulate 22621770
Alzheimer Disease Associate 31545826
Arthritis Rheumatoid Associate 25880754, 36301038
Ascites Inhibit 34363722
Breast Neoplasms Associate 27993161, 35112997
Breast Neoplasms Inhibit 31640084
Carcinogenesis Associate 18783612, 21543766
Carcinoma Hepatocellular Associate 35816613
Carcinoma Hepatocellular Inhibit 37400979
Carcinoma Non Small Cell Lung Associate 31841191, 32196605