Gene Gene information from NCBI Gene database.
Entrez ID 687
Gene name KLF transcription factor 9
Gene symbol KLF9
Synonyms (NCBI Gene)
BTEBBTEB1
Chromosome 9
Chromosome location 9q21.12
Summary The protein encoded by this gene is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates trans
miRNA miRNA information provided by mirtarbase database.
499
miRTarBase ID miRNA Experiments Reference
MIRT006886 hsa-miR-200c-3p Luciferase reporter assayWestern blot 22569286
MIRT018674 hsa-miR-335-5p Microarray 18185580
MIRT020267 hsa-miR-130b-3p Sequencing 20371350
MIRT022972 hsa-miR-124-3p Microarray 18668037
MIRT024152 hsa-miR-221-3p Sequencing 20371350
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
HOXA10 Repression 20463357
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602902 1123 ENSG00000119138
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13886
Protein name Krueppel-like factor 9 (Basic transcription element-binding protein 1) (BTE-binding protein 1) (GC-box-binding protein 1) (Transcription factor BTEB1)
Protein function Transcription factor that binds to GC box promoter elements. Selectively activates mRNA synthesis from genes containing tandem repeats of GC boxes but represses genes with a single GC box. Acts as an epidermal circadian transcription factor regu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 143 167 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 173 197 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 203 225 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Epidermis (at protein level). {ECO:0000269|PubMed:22711835}.
Sequence
MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTL
VTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSA
PSPLSLLHPGVAAKGKHASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDC
LKKFSRSDELTRHYRTH
TGEKQFRCPLCEKRFMRSDHLTKHARRHTEFHPSMIKRSKKAL
ANAL
Sequence length 244
Interactions View interactions