Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6868
Gene name Gene Name - the full gene name approved by the HGNC.	ADAM metallopeptidase domain 17
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADAM17
Synonyms (NCBI Gene) Gene synonyms aliases	ADAM18, CD156B, CSVP, NISBD, NISBD1, TACE
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p25.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes i

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs387906866	GTCT>-	Pathogenic	5 prime UTR variant, coding sequence variant, frameshift variant

Show/Hide all(364)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003112	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR	19296470
MIRT003112	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR	19296470
MIRT003112	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR	19296470
MIRT003112	hsa-miR-122-5p	Luciferase reporter assay, Review	19935707
MIRT003112	hsa-miR-122-5p	Review	20026422
MIRT003112	hsa-miR-122-5p	qRT-PCR	19726678
MIRT007275	hsa-miR-145-5p	Luciferase reporter assay	23441135
MIRT007275	hsa-miR-145-5p	Luciferase reporter assay	23441135
MIRT007275	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	23076445
0	hsa-miR-124-3p	ELISA, qRT-PCR, Immunoblot, Luciferase reporter assay	23979021
MIRT054717	hsa-miR-152-3p	ELISA, Luciferase reporter assay/qRT-PCR, Western blot	24813629
MIRT007275	hsa-miR-145-5p	Immunohistochemistry	23548270
MIRT054717	hsa-miR-152-3p	H157	24780186
MIRT054717	hsa-miR-152-3p	H157	24780186
MIRT438130	hsa-miR-26a-5p	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24375761
MIRT438130	hsa-miR-26a-5p	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24375761
MIRT438130	hsa-miR-26a-5p	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24375761
MIRT438130	hsa-miR-26a-5p	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24375761
MIRT715612	hsa-miR-302a-3p	HITS-CLIP	19536157
MIRT715611	hsa-miR-302b-3p	HITS-CLIP	19536157
MIRT715610	hsa-miR-302c-3p	HITS-CLIP	19536157
MIRT715609	hsa-miR-302d-3p	HITS-CLIP	19536157
MIRT715608	hsa-miR-302e	HITS-CLIP	19536157
MIRT715607	hsa-miR-372-3p	HITS-CLIP	19536157
MIRT715606	hsa-miR-373-3p	HITS-CLIP	19536157
MIRT715605	hsa-miR-520a-3p	HITS-CLIP	19536157
MIRT715604	hsa-miR-520b	HITS-CLIP	19536157
MIRT715603	hsa-miR-520c-3p	HITS-CLIP	19536157
MIRT715602	hsa-miR-520d-3p	HITS-CLIP	19536157
MIRT715601	hsa-miR-520e	HITS-CLIP	19536157
MIRT715600	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT715599	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT715598	hsa-miR-512-3p	HITS-CLIP	19536157
MIRT715597	hsa-miR-3691-3p	HITS-CLIP	19536157
MIRT715596	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT715595	hsa-miR-5695	HITS-CLIP	19536157
MIRT715594	hsa-miR-6722-5p	HITS-CLIP	19536157
MIRT715593	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT715592	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT705939	hsa-miR-649	HITS-CLIP	23313552
MIRT705938	hsa-miR-181a-5p	HITS-CLIP	23313552
MIRT705937	hsa-miR-181b-5p	HITS-CLIP	23313552
MIRT705936	hsa-miR-181c-5p	HITS-CLIP	23313552
MIRT705935	hsa-miR-181d-5p	HITS-CLIP	23313552
MIRT705934	hsa-miR-4262	HITS-CLIP	23313552
MIRT705933	hsa-miR-1323	HITS-CLIP	23313552
MIRT705932	hsa-miR-548o-3p	HITS-CLIP	23313552
MIRT705931	hsa-miR-149-5p	HITS-CLIP	23313552
MIRT705930	hsa-miR-3064-5p	HITS-CLIP	23313552
MIRT705929	hsa-miR-6504-5p	HITS-CLIP	23313552
MIRT705928	hsa-miR-5580-5p	HITS-CLIP	23313552
MIRT705926	hsa-miR-4284	HITS-CLIP	23313552
MIRT705927	hsa-miR-24-3p	HITS-CLIP	23313552
MIRT705924	hsa-miR-3652	HITS-CLIP	23313552
MIRT705925	hsa-miR-4430	HITS-CLIP	23313552
MIRT705923	hsa-miR-4505	HITS-CLIP	23313552
MIRT705922	hsa-miR-5787	HITS-CLIP	23313552
MIRT705921	hsa-miR-130a-5p	HITS-CLIP	23313552
MIRT705920	hsa-miR-23a-3p	HITS-CLIP	23313552
MIRT705919	hsa-miR-23b-3p	HITS-CLIP	23313552
MIRT705918	hsa-miR-23c	HITS-CLIP	23313552
MIRT705917	hsa-miR-6842-3p	HITS-CLIP	23313552
MIRT705916	hsa-miR-129-5p	HITS-CLIP	23313552
MIRT007275	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT624817	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT624816	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT624815	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT624814	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT624813	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT624812	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT624811	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT624810	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT624809	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT007275	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT624817	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT624816	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT624815	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT624814	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT624813	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT624812	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT624811	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT624810	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT624809	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT503192	hsa-miR-4465	PAR-CLIP	24398324
MIRT503191	hsa-miR-1297	PAR-CLIP	24398324
MIRT438130	hsa-miR-26a-5p	PAR-CLIP	24398324
MIRT503190	hsa-miR-26b-5p	PAR-CLIP	24398324
MIRT503189	hsa-miR-6882-5p	PAR-CLIP	24398324
MIRT503188	hsa-miR-5697	PAR-CLIP	24398324
MIRT441264	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441264	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT732080	hsa-miR-338-3p	Luciferase reporter assay, qRT-PCR, Western blot	26617808
MIRT732080	hsa-miR-338-3p	Luciferase reporter assay, qRT-PCR, Western blot	26617808
MIRT715612	hsa-miR-302a-3p	HITS-CLIP	19536157
MIRT715611	hsa-miR-302b-3p	HITS-CLIP	19536157
MIRT715610	hsa-miR-302c-3p	HITS-CLIP	19536157
MIRT715609	hsa-miR-302d-3p	HITS-CLIP	19536157
MIRT715608	hsa-miR-302e	HITS-CLIP	19536157
MIRT715607	hsa-miR-372-3p	HITS-CLIP	19536157
MIRT715606	hsa-miR-373-3p	HITS-CLIP	19536157
MIRT715605	hsa-miR-520a-3p	HITS-CLIP	19536157
MIRT715604	hsa-miR-520b	HITS-CLIP	19536157
MIRT715603	hsa-miR-520c-3p	HITS-CLIP	19536157
MIRT715602	hsa-miR-520d-3p	HITS-CLIP	19536157
MIRT715601	hsa-miR-520e	HITS-CLIP	19536157
MIRT715600	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT715599	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT715598	hsa-miR-512-3p	HITS-CLIP	19536157
MIRT715597	hsa-miR-3691-3p	HITS-CLIP	19536157
MIRT715596	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT715595	hsa-miR-5695	HITS-CLIP	19536157
MIRT715594	hsa-miR-6722-5p	HITS-CLIP	19536157
MIRT715593	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT715592	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT705939	hsa-miR-649	HITS-CLIP	23313552
MIRT705938	hsa-miR-181a-5p	HITS-CLIP	23313552
MIRT705937	hsa-miR-181b-5p	HITS-CLIP	23313552
MIRT705936	hsa-miR-181c-5p	HITS-CLIP	23313552
MIRT705935	hsa-miR-181d-5p	HITS-CLIP	23313552
MIRT705934	hsa-miR-4262	HITS-CLIP	23313552
MIRT705933	hsa-miR-1323	HITS-CLIP	23313552
MIRT705932	hsa-miR-548o-3p	HITS-CLIP	23313552
MIRT705931	hsa-miR-149-5p	HITS-CLIP	23313552
MIRT705930	hsa-miR-3064-5p	HITS-CLIP	23313552
MIRT705929	hsa-miR-6504-5p	HITS-CLIP	23313552
MIRT705928	hsa-miR-5580-5p	HITS-CLIP	23313552
MIRT705926	hsa-miR-4284	HITS-CLIP	23313552
MIRT705927	hsa-miR-24-3p	HITS-CLIP	23313552
MIRT705924	hsa-miR-3652	HITS-CLIP	23313552
MIRT705925	hsa-miR-4430	HITS-CLIP	23313552
MIRT705923	hsa-miR-4505	HITS-CLIP	23313552
MIRT705922	hsa-miR-5787	HITS-CLIP	23313552
MIRT705921	hsa-miR-130a-5p	HITS-CLIP	23313552
MIRT705920	hsa-miR-23a-3p	HITS-CLIP	23313552
MIRT705919	hsa-miR-23b-3p	HITS-CLIP	23313552
MIRT705918	hsa-miR-23c	HITS-CLIP	23313552
MIRT705917	hsa-miR-6842-3p	HITS-CLIP	23313552
MIRT705916	hsa-miR-129-5p	HITS-CLIP	23313552
MIRT007275	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT624817	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT624816	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT624815	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT624814	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT624813	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT624812	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT624811	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT624810	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT624809	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT007275	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT624817	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT624816	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT624815	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT624814	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT624813	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT624812	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT624811	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT624810	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT624809	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT503192	hsa-miR-4465	PAR-CLIP	24398324
MIRT503191	hsa-miR-1297	PAR-CLIP	24398324
MIRT438130	hsa-miR-26a-5p	PAR-CLIP	24398324
MIRT503190	hsa-miR-26b-5p	PAR-CLIP	24398324
MIRT503189	hsa-miR-6882-5p	PAR-CLIP	24398324
MIRT503188	hsa-miR-5697	PAR-CLIP	24398324
MIRT765968	hsa-miR-122	CLIP-seq
MIRT765969	hsa-miR-140-3p	CLIP-seq
MIRT765970	hsa-miR-142-3p	CLIP-seq
MIRT765971	hsa-miR-148a	CLIP-seq
MIRT765972	hsa-miR-148b	CLIP-seq
MIRT765973	hsa-miR-152	CLIP-seq
MIRT765974	hsa-miR-3135b	CLIP-seq
MIRT765975	hsa-miR-3140-3p	CLIP-seq
MIRT765976	hsa-miR-3163	CLIP-seq
MIRT765977	hsa-miR-3664-5p	CLIP-seq
MIRT765978	hsa-miR-3677-5p	CLIP-seq
MIRT765979	hsa-miR-4280	CLIP-seq
MIRT765980	hsa-miR-4446-5p	CLIP-seq
MIRT765981	hsa-miR-450b-5p	CLIP-seq
MIRT765982	hsa-miR-4639-3p	CLIP-seq
MIRT765983	hsa-miR-4697-3p	CLIP-seq
MIRT765984	hsa-miR-4755-5p	CLIP-seq
MIRT765985	hsa-miR-507	CLIP-seq
MIRT765986	hsa-miR-544	CLIP-seq
MIRT765987	hsa-miR-548a-3p	CLIP-seq
MIRT765988	hsa-miR-548ae	CLIP-seq
MIRT765989	hsa-miR-548aj	CLIP-seq
MIRT765990	hsa-miR-548am	CLIP-seq
MIRT765991	hsa-miR-548e	CLIP-seq
MIRT765992	hsa-miR-548f	CLIP-seq
MIRT765993	hsa-miR-548x	CLIP-seq
MIRT765994	hsa-miR-557	CLIP-seq
MIRT765995	hsa-miR-568	CLIP-seq
MIRT765996	hsa-miR-767-5p	CLIP-seq
MIRT765968	hsa-miR-122	CLIP-seq
MIRT765970	hsa-miR-142-3p	CLIP-seq
MIRT765974	hsa-miR-3135b	CLIP-seq
MIRT765978	hsa-miR-3677-5p	CLIP-seq
MIRT765979	hsa-miR-4280	CLIP-seq
MIRT1925698	hsa-miR-4474-5p	CLIP-seq
MIRT1925699	hsa-miR-4777-5p	CLIP-seq
MIRT1925700	hsa-miR-518d-5p	CLIP-seq
MIRT1925701	hsa-miR-519b-5p	CLIP-seq
MIRT1925702	hsa-miR-519c-5p	CLIP-seq
MIRT1925703	hsa-miR-520c-5p	CLIP-seq
MIRT1925704	hsa-miR-526a	CLIP-seq
MIRT1925705	hsa-miR-545	CLIP-seq
MIRT765987	hsa-miR-548a-3p	CLIP-seq
MIRT765988	hsa-miR-548ae	CLIP-seq
MIRT765989	hsa-miR-548aj	CLIP-seq
MIRT765990	hsa-miR-548am	CLIP-seq
MIRT765991	hsa-miR-548e	CLIP-seq
MIRT765992	hsa-miR-548f	CLIP-seq
MIRT765993	hsa-miR-548x	CLIP-seq
MIRT765968	hsa-miR-122	CLIP-seq
MIRT765970	hsa-miR-142-3p	CLIP-seq
MIRT765971	hsa-miR-148a	CLIP-seq
MIRT765972	hsa-miR-148b	CLIP-seq
MIRT765973	hsa-miR-152	CLIP-seq
MIRT765974	hsa-miR-3135b	CLIP-seq
MIRT765976	hsa-miR-3163	CLIP-seq
MIRT765977	hsa-miR-3664-5p	CLIP-seq
MIRT765978	hsa-miR-3677-5p	CLIP-seq
MIRT765979	hsa-miR-4280	CLIP-seq
MIRT765980	hsa-miR-4446-5p	CLIP-seq
MIRT1925698	hsa-miR-4474-5p	CLIP-seq
MIRT765982	hsa-miR-4639-3p	CLIP-seq
MIRT2167096	hsa-miR-4643	CLIP-seq
MIRT765983	hsa-miR-4697-3p	CLIP-seq
MIRT765984	hsa-miR-4755-5p	CLIP-seq
MIRT1925699	hsa-miR-4777-5p	CLIP-seq
MIRT1925700	hsa-miR-518d-5p	CLIP-seq
MIRT1925701	hsa-miR-519b-5p	CLIP-seq
MIRT1925702	hsa-miR-519c-5p	CLIP-seq
MIRT1925703	hsa-miR-520c-5p	CLIP-seq
MIRT1925704	hsa-miR-526a	CLIP-seq
MIRT2167097	hsa-miR-587	CLIP-seq
MIRT2167098	hsa-miR-634	CLIP-seq
MIRT765968	hsa-miR-122	CLIP-seq
MIRT765970	hsa-miR-142-3p	CLIP-seq
MIRT765974	hsa-miR-3135b	CLIP-seq
MIRT765978	hsa-miR-3677-5p	CLIP-seq
MIRT765979	hsa-miR-4280	CLIP-seq
MIRT2425929	hsa-miR-105	CLIP-seq
MIRT2425930	hsa-miR-1279	CLIP-seq
MIRT2425931	hsa-miR-145	CLIP-seq
MIRT765976	hsa-miR-3163	CLIP-seq
MIRT2425932	hsa-miR-4719	CLIP-seq
MIRT765995	hsa-miR-568	CLIP-seq
MIRT2425933	hsa-miR-582-5p	CLIP-seq
MIRT2469581	hsa-miR-1208	CLIP-seq
MIRT765968	hsa-miR-122	CLIP-seq
MIRT2469582	hsa-miR-129-3p	CLIP-seq
MIRT765970	hsa-miR-142-3p	CLIP-seq
MIRT2469583	hsa-miR-188-5p	CLIP-seq
MIRT2469584	hsa-miR-194	CLIP-seq
MIRT2469585	hsa-miR-302a	CLIP-seq
MIRT2469586	hsa-miR-302b	CLIP-seq
MIRT2469587	hsa-miR-302c	CLIP-seq
MIRT2469588	hsa-miR-302d	CLIP-seq
MIRT2469589	hsa-miR-3127-5p	CLIP-seq
MIRT765974	hsa-miR-3135b	CLIP-seq
MIRT765976	hsa-miR-3163	CLIP-seq
MIRT2469590	hsa-miR-340	CLIP-seq
MIRT2469591	hsa-miR-3529	CLIP-seq
MIRT2469592	hsa-miR-3606	CLIP-seq
MIRT2469593	hsa-miR-3651	CLIP-seq
MIRT765978	hsa-miR-3677-5p	CLIP-seq
MIRT2469594	hsa-miR-3713	CLIP-seq
MIRT2469595	hsa-miR-371b-5p	CLIP-seq
MIRT2469596	hsa-miR-372	CLIP-seq
MIRT2469597	hsa-miR-373	CLIP-seq
MIRT2469598	hsa-miR-379	CLIP-seq
MIRT2469599	hsa-miR-3918	CLIP-seq
MIRT2469600	hsa-miR-412	CLIP-seq
MIRT2469601	hsa-miR-4263	CLIP-seq
MIRT2469602	hsa-miR-4272	CLIP-seq
MIRT765979	hsa-miR-4280	CLIP-seq
MIRT2469603	hsa-miR-4438	CLIP-seq
MIRT2469604	hsa-miR-4451	CLIP-seq
MIRT2469605	hsa-miR-4464	CLIP-seq
MIRT1925698	hsa-miR-4474-5p	CLIP-seq
MIRT2469606	hsa-miR-4650-3p	CLIP-seq
MIRT2469607	hsa-miR-4687-5p	CLIP-seq
MIRT2469608	hsa-miR-4698	CLIP-seq
MIRT2469609	hsa-miR-4699-5p	CLIP-seq
MIRT2469610	hsa-miR-4724-3p	CLIP-seq
MIRT2469611	hsa-miR-4731-5p	CLIP-seq
MIRT2469612	hsa-miR-4748	CLIP-seq
MIRT2469613	hsa-miR-4766-5p	CLIP-seq
MIRT1925699	hsa-miR-4777-5p	CLIP-seq
MIRT2469614	hsa-miR-4794	CLIP-seq
MIRT2469615	hsa-miR-5095	CLIP-seq
MIRT1925700	hsa-miR-518d-5p	CLIP-seq
MIRT1925701	hsa-miR-519b-5p	CLIP-seq
MIRT1925702	hsa-miR-519c-5p	CLIP-seq
MIRT1925703	hsa-miR-520c-5p	CLIP-seq
MIRT1925704	hsa-miR-526a	CLIP-seq
MIRT1925705	hsa-miR-545	CLIP-seq
MIRT765987	hsa-miR-548a-3p	CLIP-seq
MIRT2469616	hsa-miR-548aa	CLIP-seq
MIRT765988	hsa-miR-548ae	CLIP-seq
MIRT2469617	hsa-miR-548ag	CLIP-seq
MIRT2469618	hsa-miR-548ai	CLIP-seq
MIRT765989	hsa-miR-548aj	CLIP-seq
MIRT765990	hsa-miR-548am	CLIP-seq
MIRT765991	hsa-miR-548e	CLIP-seq
MIRT765992	hsa-miR-548f	CLIP-seq
MIRT765993	hsa-miR-548x	CLIP-seq
MIRT2469619	hsa-miR-576-5p	CLIP-seq
MIRT2167097	hsa-miR-587	CLIP-seq
MIRT2469620	hsa-miR-802	CLIP-seq
MIRT2469621	hsa-miR-876-3p	CLIP-seq
MIRT2469622	hsa-miR-892b	CLIP-seq
MIRT2469581	hsa-miR-1208	CLIP-seq
MIRT765968	hsa-miR-122	CLIP-seq
MIRT2469582	hsa-miR-129-3p	CLIP-seq
MIRT765970	hsa-miR-142-3p	CLIP-seq
MIRT2469583	hsa-miR-188-5p	CLIP-seq
MIRT2469584	hsa-miR-194	CLIP-seq
MIRT2469585	hsa-miR-302a	CLIP-seq
MIRT2469586	hsa-miR-302b	CLIP-seq
MIRT2469587	hsa-miR-302c	CLIP-seq
MIRT2469588	hsa-miR-302d	CLIP-seq
MIRT2469589	hsa-miR-3127-5p	CLIP-seq
MIRT765974	hsa-miR-3135b	CLIP-seq
MIRT765976	hsa-miR-3163	CLIP-seq
MIRT2469590	hsa-miR-340	CLIP-seq
MIRT2469591	hsa-miR-3529	CLIP-seq
MIRT2469592	hsa-miR-3606	CLIP-seq
MIRT2469593	hsa-miR-3651	CLIP-seq
MIRT765978	hsa-miR-3677-5p	CLIP-seq
MIRT2469594	hsa-miR-3713	CLIP-seq
MIRT2469595	hsa-miR-371b-5p	CLIP-seq
MIRT2469596	hsa-miR-372	CLIP-seq
MIRT2469597	hsa-miR-373	CLIP-seq
MIRT2469598	hsa-miR-379	CLIP-seq
MIRT2469599	hsa-miR-3918	CLIP-seq
MIRT2469600	hsa-miR-412	CLIP-seq
MIRT2469601	hsa-miR-4263	CLIP-seq
MIRT2469602	hsa-miR-4272	CLIP-seq
MIRT765979	hsa-miR-4280	CLIP-seq
MIRT2469603	hsa-miR-4438	CLIP-seq
MIRT2469604	hsa-miR-4451	CLIP-seq
MIRT2469606	hsa-miR-4650-3p	CLIP-seq
MIRT2469607	hsa-miR-4687-5p	CLIP-seq
MIRT2469608	hsa-miR-4698	CLIP-seq
MIRT2469609	hsa-miR-4699-5p	CLIP-seq
MIRT2469611	hsa-miR-4731-5p	CLIP-seq
MIRT2469613	hsa-miR-4766-5p	CLIP-seq
MIRT2469614	hsa-miR-4794	CLIP-seq
MIRT2469615	hsa-miR-5095	CLIP-seq
MIRT1925705	hsa-miR-545	CLIP-seq
MIRT765987	hsa-miR-548a-3p	CLIP-seq
MIRT2469616	hsa-miR-548aa	CLIP-seq
MIRT765988	hsa-miR-548ae	CLIP-seq
MIRT765989	hsa-miR-548aj	CLIP-seq
MIRT765990	hsa-miR-548am	CLIP-seq
MIRT765991	hsa-miR-548e	CLIP-seq
MIRT765992	hsa-miR-548f	CLIP-seq
MIRT765993	hsa-miR-548x	CLIP-seq
MIRT2469619	hsa-miR-576-5p	CLIP-seq
MIRT2167097	hsa-miR-587	CLIP-seq
MIRT2469620	hsa-miR-802	CLIP-seq
MIRT2469622	hsa-miR-892b	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
SP1	Activation	22705645
SP1	Unknown	19772640

Show/Hide all(108)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001666	Process	Response to hypoxia	IDA	18276953
GO:0002446	Process	Neutrophil mediated immunity	IC	16034137
GO:0002467	Process	Germinal center formation	IEA
GO:0002467	Process	Germinal center formation	ISS	10433800
GO:0002532	Process	Production of molecular mediator involved in inflammatory response	IEA
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	IC	16034137
GO:0004175	Function	Endopeptidase activity	IEA
GO:0004175	Function	Endopeptidase activity	IMP	24990881, 25049354
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IDA	9774383, 9920899, 14625290, 15691827, 17010968, 18355445, 24226769, 24337742, 36476876
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	IMP	9034190, 9034191
GO:0004222	Function	Metalloendopeptidase activity	TAS
GO:0005112	Function	Notch binding	IDA	24226769
GO:0005138	Function	Interleukin-6 receptor binding	IPI	16034137
GO:0005178	Function	Integrin binding	IPI	14970227
GO:0005515	Function	Protein binding	IPI	9774383, 10527948, 12668732, 15280379, 18355445, 18625725, 18638486, 22246777, 22413019, 29897336, 30455686, 32405532
GO:0005737	Component	Cytoplasm	IDA	25468996
GO:0005737	Component	Cytoplasm	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	17786981, 24337742
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IDA	14970227
GO:0005925	Component	Focal adhesion	IDA	14970227
GO:0006508	Process	Proteolysis	IDA	24227843
GO:0006508	Process	Proteolysis	IEA
GO:0006509	Process	Membrane protein ectodomain proteolysis	IBA
GO:0006509	Process	Membrane protein ectodomain proteolysis	IDA	9034190, 9574564, 14625290, 15691827, 17010968, 17786981, 18355445, 18676862, 24337742, 36476876
GO:0006509	Process	Membrane protein ectodomain proteolysis	IEA
GO:0006509	Process	Membrane protein ectodomain proteolysis	IEA
GO:0006509	Process	Membrane protein ectodomain proteolysis	IMP	9034191, 12743035, 16034137, 18373975, 21170088, 24990881
GO:0007155	Process	Cell adhesion	IDA	14970227
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	18483258
GO:0007219	Process	Notch signaling pathway	IBA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007220	Process	Notch receptor processing	IDA	24226769
GO:0008233	Function	Peptidase activity	IEA
GO:0008233	Function	Peptidase activity	TAS	24966471
GO:0008237	Function	Metallopeptidase activity	IDA	12777399
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IMP	12535668
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18373975
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009410	Process	Response to xenobiotic stimulus	ISS	10433800
GO:0009967	Process	Positive regulation of signal transduction	IEA
GO:0009986	Component	Cell surface	IDA	9034190, 18383040, 18625725
GO:0010820	Process	Positive regulation of T cell chemotaxis	IMP	18373975
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0015629	Component	Actin cytoskeleton	IDA	17010968
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	16034137
GO:0016485	Process	Protein processing	IDA	9774383
GO:0016787	Function	Hydrolase activity	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0019955	Function	Cytokine binding	IPI	12777399
GO:0023061	Process	Signal release	IDA	12777399
GO:0030165	Function	PDZ domain binding	IPI	12207026
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	ISS	10433800
GO:0030307	Process	Positive regulation of cell growth	IMP	18373975
GO:0030335	Process	Positive regulation of cell migration	IDA	26617808
GO:0030335	Process	Positive regulation of cell migration	IMP	18373975
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IMP	21170088
GO:0032496	Process	Response to lipopolysaccharide	IDA	18383040
GO:0032587	Component	Ruffle membrane	IDA	14970227
GO:0032722	Process	Positive regulation of chemokine production	IMP	16034137
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	12777399, 18355445
GO:0033025	Process	Regulation of mast cell apoptotic process	IEA
GO:0033025	Process	Regulation of mast cell apoptotic process	ISS	10433800
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033077	Process	T cell differentiation in thymus	ISS	10433800
GO:0033627	Process	Cell adhesion mediated by integrin	IDA	14970227
GO:0035313	Process	Wound healing, spreading of epidermal cells	IEP	14970227
GO:0042987	Process	Amyloid precursor protein catabolic process	IDA	9774383
GO:0043120	Function	Tumor necrosis factor binding	IDA	25049354
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	18483258
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	24813629
GO:0045121	Component	Membrane raft	IDA	17010968, 17786981
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IDA	12743035
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IEA
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IMP	17655843
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	ISS	10433800
GO:0046872	Function	Metal ion binding	IEA
GO:0048536	Process	Spleen development	IEA
GO:0048536	Process	Spleen development	ISS	10433800
GO:0048679	Process	Regulation of axon regeneration	IEA
GO:0048870	Process	Cell motility	IEA
GO:0048870	Process	Cell motility	ISS	10433800
GO:0050830	Process	Defense response to Gram-positive bacterium	IMP	16034137
GO:0070573	Function	Metallodipeptidase activity	IEA
GO:0071403	Process	Cellular response to high density lipoprotein particle stimulus	IDA	17786981
GO:0071679	Process	Commissural neuron axon guidance	IMP	36476876
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	18687778
GO:0140447	Process	Cytokine precursor processing	IDA	24813629
GO:0140448	Process	Signaling receptor ligand precursor processing	IEA
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IMP	18483258
GO:1902945	Function	Metalloendopeptidase activity involved in amyloid precursor protein catabolic process	IDA	9774383
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IDA	18355445
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IMP	24813629
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IDA	24813629
GO:2001222	Process	Regulation of neuron migration	IEA

MIM	HGNC	e!Ensembl
603639	195	ENSG00000151694

Protein

UniProt ID

P78536

Protein name

Disintegrin and metalloproteinase domain-containing protein 17 (ADAM 17) (EC 3.4.24.86) (Snake venom-like protease) (TNF-alpha convertase) (TNF-alpha-converting enzyme) (CD antigen CD156b)

Protein function

Transmembrane metalloprotease which mediates the ectodomain shedding of a myriad of transmembrane proteins including adhesion proteins, growth factor precursors and cytokines important for inflammation and immunity (PubMed:24226769, PubMed:24227

PDB

1BKC , 1ZXC , 2A8H , 2DDF , 2FV5 , 2FV9 , 2I47 , 2M2F , 2OI0 , 3B92 , 3CKI , 3E8R , 3EDZ , 3EWJ , 3G42 , 3KMC , 3KME , 3L0T , 3L0V , 3LE9 , 3LEA , 3LGP , 3O64 , 8CQY , 8SNL , 8SNN , 8SNO , 9E6K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01562	Pep_M12B_propep	31 → 167	Reprolysin family propeptide	Family
PF13688	Reprolysin_5	221 → 451		Family
PF00200	Disintegrin	484 → 558	Disintegrin	Domain
PF16698	ADAM17_MPD	581 → 642	Membrane-proximal domain, switch, for ADAM17	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Expressed at highest levels in adult heart, placenta, skeletal muscle, pancreas, spleen, thymus, prostate, testes, ovary and small intestine, and in fetal brain, lung, liver and kidney. Expressed in natural kill

Sequence

MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDL
QTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVV
GEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQS
PKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYRYMG
RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNM
AKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS
HGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN
SRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINA
TCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSC
KVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS
INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMD
SASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKD
PFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC

Sequence length

824

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis Notch signaling pathway TNF signaling pathway Alzheimer disease Epithelial cell signaling in Helicobacter pylori infection Coronavirus disease - COVID-19		Regulated proteolysis of p75NTR Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 t(7;9)(NOTCH1:M1580_K2555) Translocation Mutant Constitutive Signaling by NOTCH1 HD Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants TNF signaling CD163 mediating an anti-inflammatory response

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Inflammatory Skin And Bowel Disease	inflammatory skin and bowel disease, neonatal, 1	rs387906866, rs1572897958, rs1662434135, rs1662343008	N/A

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Anophthalmia/Microphthalmia-Esophageal Atresia Syndrome	Anophthalmia-microphthalmia syndrome	N/A	N/A	ClinVar
Congenital Heart Disease	congenital heart disease	N/A	N/A	GenCC

Show/Hide Text Mining Associations (143)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Kidney Injury	Associate	19535569
Adenocarcinoma of Lung	Associate	26111641, 28960861
Alzheimer Disease	Associate	21368376, 29988083, 30045751
Alzheimer Disease	Stimulate	24685635
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Stimulate	25788529
Aortic Aneurysm Abdominal	Associate	24853957
Arteriovenous Malformations	Associate	29932521, 32962750
Arthritis Rheumatoid	Associate	12237470, 16079149, 24314260, 30071898
Asthma	Stimulate	16481637
Asthma	Associate	33455043, 35130903
Atherosclerosis	Associate	24727681
Bacterial Infections	Associate	17220369
Behcet Syndrome	Stimulate	28049760
Brain Neoplasms	Associate	19395875
Breast Neoplasms	Stimulate	15565459
Breast Neoplasms	Associate	16251361, 17218988, 17227756, 18238782, 18625725, 19395875, 21240579, 22967992, 24736554, 26260680, 28232483, 32986377, 34281556
Bronchitis Chronic	Associate	39682757
Calcinosis	Associate	37427430
Carcinogenesis	Associate	19843672, 36813090
Carcinoma Hepatocellular	Associate	15309730, 30297396, 32210451, 38069391
Carcinoma Hepatocellular	Stimulate	39346916
Carcinoma Merkel Cell	Stimulate	30188954
Carcinoma Non Small Cell Lung	Associate	23475633, 24780186, 25363527
Carcinoma Pancreatic Ductal	Associate	24520077
Carcinoma Renal Cell	Associate	23441135, 23659326
Cardiomyopathies	Associate	22010916
Cardiovascular Diseases	Associate	38199832
Cerebral Infarction	Associate	24727681
Cerebrovascular Disorders	Associate	25788529
Chemical and Drug Induced Liver Injury	Associate	25804906
Cholangiocarcinoma	Associate	35223192
Cognition Disorders	Stimulate	24685635
Cognition Disorders	Associate	36229517
Cognitive Dysfunction	Stimulate	24685635
Colorectal Neoplasms	Associate	21855041, 22665490, 26744411, 27110571, 27874952, 30069943, 32450419, 34576100, 34726248, 36270986, 39644618
Colorectal Neoplasms	Stimulate	24520077
Conjunctivitis Allergic	Stimulate	26989694
COVID 19	Associate	32664949, 34445140, 35720350, 36229517, 36292769, 36558177, 37958866
Crohn Disease	Associate	19299578, 36621146
Cystic Fibrosis	Associate	29351448
Cytokine Release Syndrome	Associate	20922190
Death	Associate	34445140
Dermatitis	Associate	25804906
Diabetes Mellitus	Associate	29561187
Diabetes Mellitus Type 2	Stimulate	17714581, 36018759
Diabetes Mellitus Type 2	Associate	19633828, 23811853, 29561187
Diabetic Angiopathies	Associate	25788529
Diabetic Nephropathies	Associate	26990852
Diarrhea	Associate	25804906
Disease	Associate	24643277, 36229517
Drug Hypersensitivity	Associate	35130903
Drug Related Side Effects and Adverse Reactions	Associate	20679348, 22389670
Epidermodysplasia Verruciformis	Associate	37427430
Esophageal Neoplasms	Associate	25966212
Esophageal Squamous Cell Carcinoma	Associate	25351873, 25966212, 36813090
Familial Primary Pulmonary Hypertension	Associate	25840998
Fibrosis	Associate	19535569, 32664949
Fractures Stress	Associate	35130903
Gastrointestinal Stromal Tumors	Associate	19298600
Glioblastoma	Associate	19657395, 27541285, 31142630, 32326230, 37175410
Glioma	Associate	19395875, 19772640, 21359495, 24185966, 29131255, 36639372
Glomerulonephritis	Associate	19535569
Glomerulonephritis Membranous	Stimulate	19435795
Glycosuria Renal	Associate	23659326
Head and Neck Neoplasms	Associate	19843672, 21102583
Heart Failure	Stimulate	15556048
Hepatitis B Chronic	Associate	26217090
Hereditary Breast and Ovarian Cancer Syndrome	Associate	21240579
Hippocampal Sclerosis	Associate	32189710
HIV Infections	Associate	27773542
Hyperoxia	Inhibit	27093376
Hypoxia	Associate	16278664, 19772640
Hypoxia	Inhibit	27093376
Hypoxia Brain	Associate	19772640
Infertility Male	Associate	34944080
Inflammation	Associate	19951006, 22157716, 24643277, 24727681, 25867908, 26064952, 27561911, 29980709, 33585287, 34726248, 35199397, 37566005, 38069391
Inflammatory Bowel Diseases	Associate	14678276, 22010916, 33359885
Insulin Resistance	Associate	19633828, 19819120, 21984580, 36018759
Iron Overload	Associate	29980709
Isolated Systolic Hypertension	Associate	25804906
Kidney Diseases	Associate	19535569, 25788529
Kidney Neoplasms	Associate	23441135, 23659326
Klatskin Tumor	Associate	29776401
Leiomyoma	Associate	17716379
Leukemia	Associate	20679348
Liver Cirrhosis	Associate	19432809
Liver Diseases	Associate	19432809
Lung Neoplasms	Associate	25363527
Lymphatic Metastasis	Associate	21102583, 24793016, 25351873, 30569104
Lymphatic Metastasis	Stimulate	23475633, 25966212
Lymphoma Follicular	Associate	22473939
Macrophage Activation Syndrome	Associate	19292764
Malaria	Associate	27784899
Melanoma	Associate	18971959, 23645517, 25491779, 34224305
Mesothelioma Malignant	Associate	35262190
Multiple Myeloma	Associate	22389670
Multiple Organ Failure	Associate	25804906
Myasthenia Gravis	Associate	38325197
Myocarditis	Associate	11028485, 22010916
Neoplasm Invasiveness	Associate	35720350
Neoplasm Metastasis	Associate	25966212, 27110571, 27874952, 38069391, 39644618
Neoplasms	Associate	12743035, 17227756, 18238782, 18971959, 19298600, 19772640, 19843672, 20098684, 21102583, 21175594, 21240579, 23317503, 23441135, 24130797, 24643277 View all (20 more)
Neoplasms	Stimulate	23475633
Nephritis	Associate	28063160
Neuralgia	Associate	35462614
Neuroblastoma	Associate	19959661
Neurodegenerative Diseases	Associate	36229517
Non alcoholic Fatty Liver Disease	Associate	36055749
Obesity	Associate	19819120
Osteoarthritis	Associate	16806998
Ovarian Neoplasms	Associate	21175594, 24518602, 28232483, 28387913, 32851734
Pancreatic Neoplasms	Associate	19603023, 33498866
Pancreatitis	Associate	31507587
Paresis	Associate	31507587
Periodontal Diseases	Stimulate	21777519
Periodontitis	Associate	21777519, 27815441
Pre Eclampsia	Associate	37374349
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Stimulate	35831551
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	25246708
Preeclamptic toxemia	Associate	37374349
Prostatic Neoplasms	Associate	24385212, 33204367
Pulmonary Disease Chronic Obstructive	Associate	15121636, 21861887, 27561911, 39682757
Renal Insufficiency Chronic	Associate	29561187
Retinoblastoma	Associate	36293469
Sarcoidosis	Stimulate	19292764
Schizophrenia	Associate	22590542, 28049760
Scleroderma Systemic	Stimulate	16014681
Sepsis	Associate	25867908
Severe Acute Respiratory Syndrome	Associate	29980709
Sjogren's Syndrome	Associate	22157716, 33446013
Skin Diseases	Associate	25804906
Squamous Cell Carcinoma of Head and Neck	Stimulate	21102583
Squamous Cell Carcinoma of Head and Neck	Associate	27349552, 29171106, 38063205
Stomach Neoplasms	Associate	21435459, 24008668, 25499189, 26617808, 30569104, 36430322
Stroke	Associate	19395875, 24727681
Systemic Inflammatory Response Syndrome	Associate	25867908
Telangiectasia Hereditary Hemorrhagic	Associate	29932521
Thrombosis	Associate	32423094
Triple Negative Breast Neoplasms	Associate	22967992, 23729230, 31796994
Uterine Cervical Neoplasms	Associate	24793016, 27581326
Ventricular Remodeling	Associate	39457420
Virus Diseases	Associate	32385608, 36558177
Vitamin B 12 Deficiency	Stimulate	19959661

ADAM17 (ADAM metallopeptidase domain 17)