Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6865
Gene name	Tachykinin receptor 2
Gene symbol	TACR2
Synonyms (NCBI Gene)	NK2RNKNARSKRTAC2R
Chromosome	10
Chromosome location	10q22.1
Summary	This gene belongs to a family of genes that function as receptors for tachykinins. Receptor affinities are specified by variations in the 5`-end of the sequence. The receptors belonging to this family are characterized by interactions with G proteins an

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017841	hsa-miR-335-5p	Microarray	18185580
MIRT645579	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT645578	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT645576	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT645577	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT645575	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT645574	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT645573	hsa-miR-1976	HITS-CLIP	23824327
MIRT645572	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT645571	hsa-miR-4252	HITS-CLIP	23824327
MIRT645570	hsa-miR-1254	HITS-CLIP	23824327
MIRT645569	hsa-miR-3116	HITS-CLIP	23824327
MIRT645568	hsa-miR-661	HITS-CLIP	23824327
MIRT645567	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT645566	hsa-miR-7703	HITS-CLIP	23824327
MIRT569262	hsa-miR-4293	PAR-CLIP	20371350
MIRT569261	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT569260	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT569262	hsa-miR-4293	PAR-CLIP	20371350
MIRT569261	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT569260	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT645579	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT645578	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT645576	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT645577	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT645575	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT645574	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT645573	hsa-miR-1976	HITS-CLIP	23824327
MIRT645572	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT645571	hsa-miR-4252	HITS-CLIP	23824327
MIRT645570	hsa-miR-1254	HITS-CLIP	23824327
MIRT645569	hsa-miR-3116	HITS-CLIP	23824327
MIRT645568	hsa-miR-661	HITS-CLIP	23824327
MIRT645567	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT645566	hsa-miR-7703	HITS-CLIP	23824327
MIRT569262	hsa-miR-4293	PAR-CLIP	20371350
MIRT569261	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT569260	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT569262	hsa-miR-4293	PAR-CLIP	20371350
MIRT569261	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT569260	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT1408517	hsa-miR-1260	CLIP-seq
MIRT1408518	hsa-miR-1260b	CLIP-seq
MIRT1408519	hsa-miR-1273f	CLIP-seq
MIRT1408520	hsa-miR-1292	CLIP-seq
MIRT1408521	hsa-miR-1293	CLIP-seq
MIRT1408522	hsa-miR-141	CLIP-seq
MIRT1408523	hsa-miR-142-5p	CLIP-seq
MIRT1408524	hsa-miR-143	CLIP-seq
MIRT1408525	hsa-miR-150	CLIP-seq
MIRT1408526	hsa-miR-186	CLIP-seq
MIRT1408527	hsa-miR-188-3p	CLIP-seq
MIRT1408528	hsa-miR-200a	CLIP-seq
MIRT1408529	hsa-miR-24	CLIP-seq
MIRT1408530	hsa-miR-3122	CLIP-seq
MIRT1408531	hsa-miR-3133	CLIP-seq
MIRT1408532	hsa-miR-3155	CLIP-seq
MIRT1408533	hsa-miR-3155b	CLIP-seq
MIRT1408534	hsa-miR-3156-3p	CLIP-seq
MIRT1408535	hsa-miR-3162-3p	CLIP-seq
MIRT1408536	hsa-miR-3202	CLIP-seq
MIRT1408537	hsa-miR-340	CLIP-seq
MIRT1408538	hsa-miR-3909	CLIP-seq
MIRT1408539	hsa-miR-3910	CLIP-seq
MIRT1408540	hsa-miR-3913-5p	CLIP-seq
MIRT1408541	hsa-miR-3921	CLIP-seq
MIRT1408542	hsa-miR-4251	CLIP-seq
MIRT1408543	hsa-miR-4284	CLIP-seq
MIRT1408544	hsa-miR-4299	CLIP-seq
MIRT1408545	hsa-miR-4329	CLIP-seq
MIRT1408546	hsa-miR-4456	CLIP-seq
MIRT1408547	hsa-miR-4471	CLIP-seq
MIRT1408548	hsa-miR-4483	CLIP-seq
MIRT1408549	hsa-miR-4493	CLIP-seq
MIRT1408550	hsa-miR-4533	CLIP-seq
MIRT1408551	hsa-miR-4653-5p	CLIP-seq
MIRT1408552	hsa-miR-4708-5p	CLIP-seq
MIRT1408553	hsa-miR-4770	CLIP-seq
MIRT1408554	hsa-miR-484	CLIP-seq
MIRT1408555	hsa-miR-548q	CLIP-seq
MIRT1408556	hsa-miR-554	CLIP-seq
MIRT1408557	hsa-miR-583	CLIP-seq
MIRT2344965	hsa-miR-3125	CLIP-seq
MIRT2344966	hsa-miR-3916	CLIP-seq
MIRT2344967	hsa-miR-4311	CLIP-seq
MIRT2344968	hsa-miR-4710	CLIP-seq
MIRT2344969	hsa-miR-4717-3p	CLIP-seq
MIRT2344970	hsa-miR-4792	CLIP-seq
MIRT1408523	hsa-miR-142-5p	CLIP-seq
MIRT1408526	hsa-miR-186	CLIP-seq
MIRT1408531	hsa-miR-3133	CLIP-seq
MIRT1408537	hsa-miR-340	CLIP-seq
MIRT2461057	hsa-miR-3672	CLIP-seq
MIRT1408557	hsa-miR-583	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004995	Function	Tachykinin receptor activity	IEA
GO:0004995	Function	Tachykinin receptor activity	TAS	8307161
GO:0005515	Function	Protein binding	IPI	12716968, 23597562
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2173708
GO:0006936	Process	Muscle contraction	TAS	2173708
GO:0006940	Process	Regulation of smooth muscle contraction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007217	Process	Tachykinin receptor signaling pathway	TAS	8307161
GO:0014057	Process	Positive regulation of acetylcholine secretion, neurotransmission	IEA
GO:0014827	Process	Intestine smooth muscle contraction	IEA
GO:0016020	Component	Membrane	IEA
GO:0016497	Function	Substance K receptor activity	IBA
GO:0016497	Function	Substance K receptor activity	IEA
GO:0033685	Process	Negative regulation of luteinizing hormone secretion	IEA
GO:0035106	Process	Operant conditioning	IEA
GO:0036126	Component	Sperm flagellum	IDA	17437961
GO:0043117	Process	Positive regulation of vascular permeability	IEA
GO:0043270	Process	Positive regulation of monoatomic ion transport	IEA
GO:0045987	Process	Positive regulation of smooth muscle contraction	TAS	10862829
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0061827	Component	Sperm head	IDA	17437961
GO:0070459	Process	Prolactin secretion	IEA
GO:0070472	Process	Regulation of uterine smooth muscle contraction	IEA
GO:0070474	Process	Positive regulation of uterine smooth muscle contraction	IEA
GO:0097225	Component	Sperm midpiece	IBA
GO:0097225	Component	Sperm midpiece	IDA	17437961
GO:1902093	Process	Positive regulation of flagellated sperm motility	IBA
GO:1902093	Process	Positive regulation of flagellated sperm motility	IMP	17437961

MIM	HGNC	e!Ensembl
162321	11527	ENSG00000075073

P21452

Protein name

Substance-K receptor (SKR) (NK-2 receptor) (NK-2R) (Neurokinin A receptor) (Tachykinin receptor 2)

Protein function

This is a receptor for the tachykinin neuropeptide substance K (neurokinin A). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is:

PDB

7XWO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	50 → 307	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK
CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR
HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA
GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI

Sequence length

398

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction		Tachykinin receptors bind tachykinins G alpha (q) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Colitis Ulcerative	Associate	11073811	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cough	Associate	16893949, 35509099	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Stimulate	11073811	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Inhibit	20008142	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	11073811	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	11073811	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Associate	27456549	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoma Adult T Cell	Associate	34446027	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Associate	34446027	★★★★★ ★☆☆☆☆ Found in Text Mining only

TACR2 (tachykinin receptor 2)