Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6863
Gene name Gene Name - the full gene name approved by the HGNC.
Tachykinin precursor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TAC1
Synonyms (NCBI Gene) Gene synonyms aliases
Hs.2563, NK2, NKNA, NPK, TAC2
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and neuropeptide gamma. These hormones are thought to function as neurotransmitters which interact with
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003005 hsa-miR-130a-3p Luciferase reporter assay 17855557
MIRT003004 hsa-miR-206 Luciferase reporter assay 17855557
MIRT003003 hsa-miR-320a Luciferase reporter assay 17855557
MIRT020344 hsa-miR-302a-3p Reporter assay 17855557
MIRT003004 hsa-miR-206 Reporter assay;Other 17855557
Transcription factors
Transcription factor Regulation Reference
REST Repression 12220737;19246391
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001878 Process Response to yeast IDA 18603306
GO:0002675 Process Positive regulation of acute inflammatory response IEA
GO:0003085 Process Negative regulation of systemic arterial blood pressure IDA 12716968
GO:0005515 Function Protein binding IPI 12609765, 23597562
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
162320 11517 ENSG00000006128
Protein
UniProt ID P20366
Protein name Protachykinin-1 (PPT) [Cleaved into: Substance P; Neurokinin A (NKA) (Neuromedin L) (Substance K); Neuropeptide K (NPK); Neuropeptide gamma; C-terminal-flanking peptide]
Protein function Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.
PDB 2B19 , 2KS9 , 2KSA , 2KSB , 4HOM , 7P00 , 7P02 , 7RMG , 7RMH , 7VDM , 7XWO , 8JBH , 8U26
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02202 Tachykinin 58 68 Tachykinin family Family
Sequence
MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPK
PQQFFGLM
GKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERS
AMQNYERRR
Sequence length 129
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Neuroactive ligand-receptor interaction   Tachykinin receptors bind tachykinins
G alpha (q) signalling events
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cervical Cancer Cervical cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abdominal Pain Associate 23582152
Adenocarcinoma of Lung Associate 38548216
Adenoma Associate 27896617
Alzheimer Disease Associate 26402107, 32304290, 36635346, 36776063
Anosmia Associate 36549578
Anxiety Associate 19545476
Arthritis Associate 25578529
Arthritis Psoriatic Associate 15899028, 9534881
Arthritis Rheumatoid Associate 1374227, 15899028, 28366675, 9717978
Asthma Associate 10197222, 10573219, 28179442, 35190755