Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6854
Gene name Gene Name - the full gene name approved by the HGNC.
Synapsin II
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SYN2
Synonyms (NCBI Gene) Gene synonyms aliases
SYNII
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p25.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptog
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1405397 hsa-miR-1 CLIP-seq
MIRT1405398 hsa-miR-206 CLIP-seq
MIRT1405399 hsa-miR-3121-3p CLIP-seq
MIRT1405400 hsa-miR-3190 CLIP-seq
MIRT1405401 hsa-miR-3202 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
EGR1 Unknown 7592648
ETV4 Unknown 7592648
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 23406870, 33961781
GO:0005524 Function ATP binding IEA
GO:0005524 Function ATP binding TAS 15217342
GO:0005886 Component Plasma membrane IEA
GO:0007268 Process Chemical synaptic transmission IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600755 11495 ENSG00000157152
Protein
UniProt ID Q92777
Protein name Synapsin-2 (Synapsin II)
Protein function Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. May play a role in noradrenaline secretion by sympathetic neurons (By similarity). {ECO:0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10581 Synapsin_N 2 39 Synapsin N-terminal Domain
PF02078 Synapsin 111 212 Synapsin, N-terminal domain Domain
PF02750 Synapsin_C 214 416 Synapsin, ATP binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Central and peripheral nervous systems.
Sequence
MMNFLRRRLSDSSFIANLPNGYMTDLQRPEPQQPPPPPPPGPGAASASAAPPTASPGPER
RPPPASAPAPQPAPTPSVGSSFFSSLSQAVKQTAASAGLVDAPAPAPAAARKAKVLLVVD
EPHADWAKCFRGKKVLGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRP
DFVLIRQHAFGMAENEDFRHLIIGMQYAGLPS
INSLESIYNFCDKPWVFAQLVAIYKTLG
GEKFPLIEQTYYPNHKEMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQT
YATAEPFIDSKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDTC
SEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITELVISKMNQ
LLSR
TPALSPQRPLTTQQPQSGTLKDPDSSKTPPQRPPPQGGPGQPQGMQPPGKVLPPRRLPPG
PSLPPSSSSSSSSSSSAPQRPGGPTTHGDAPSSSSSLAEAQPPLAAPPQKPQPHPQLNKS
QSLTNAFSFSESSFFRSSANEDEAKAETIRSLRKSFASLFSD
Sequence length 582
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Serotonin Neurotransmitter Release Cycle
Dopamine Neurotransmitter Release Cycle
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Acne acne vulgaris N/A N/A GWAS
Diabetes Type 2 diabetes, Circulating leptin levels or type 2 diabetes, Diabetic kidney disease in type 2 diabetes (ESRD vs. no ESRD), Type 2 diabetes or prostate cancer (pleiotropy) N/A N/A GWAS
Hypothyroidism Hypothyroidism N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 39650656
Bipolar Disorder Associate 22384280, 27515700
Bone Diseases Metabolic Associate 29763751
COVID 19 Associate 34299101
Depressive Disorder Major Associate 27515700
Diabetes Mellitus Type 2 Associate 21084393, 32948839
Epilepsy Associate 22571925
Mental Disorders Associate 22571925
Mood Disorders Associate 27515700
Mucocutaneous Lymph Node Syndrome Associate 37894766